BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB1987 533033 532719 -105 !not a gene! (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71039 hypothetical protein PH1604 - Pyrococcus horikoshii ... 68 3e-11 >pir||D71039 hypothetical protein PH1604 - Pyrococcus horikoshii >gi|3258033|dbj|BAA30716.1| (AP000006) 120aa long hypothetical protein [Pyrococcus horikoshii] Length = 120 Score = 67.9 bits (163), Expect = 3e-11 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 8/102 (7%) Query: 1 MDNYAVGYEVVGLMVNANVIEFGVFRLDPFNLYNLLSNEATLVTPLLGKLFKGREVILNG 60 M++ VGYE++G MVN +V+E VFR + FNL +L NE+T V+ + K FK E+ Sbjct: 1 MNDDTVGYEIMGTMVNTDVVELIVFRFNAFNLNDLFCNESTFVSSIPCKFFKCHEIP--- 57 Query: 61 FVSFFYNALLELKVGSRNEALDLLLGVILVVYPLNEGSNAVL 102 ++ LLELKV +++ L L ++L+V E AVL Sbjct: 58 -----FHELLELKVSVSDKSPGLFLRIVLIVNSTQEVPYAVL 94 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.145 0.410 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35979596 Number of Sequences: 2977 Number of extensions: 1290915 Number of successful extensions: 2528 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2527 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 51 effective length of query: 54 effective length of database: 158,583,909 effective search space: 8563531086 effective search space used: 8563531086 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)