BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2008 506999 506502 -166 !not a gene! (166 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71043 hypothetical protein PH1635 - Pyrococcus horikoshii ... 162 2e-39 pir||E72557 hypothetical protein APE1745 - Aeropyrum pernix (str... 85 4e-16 >pir||C71043 hypothetical protein PH1635 - Pyrococcus horikoshii >gi|3258064|dbj|BAA30747.1| (AP000006) 148aa long hypothetical protein [Pyrococcus horikoshii] Length = 148 Score = 162 bits (406), Expect = 2e-39 Identities = 87/116 (75%), Positives = 91/116 (78%) Query: 51 IKPSAXXXXXXXXXXXXTPLPFGFLLISSSIVMASPPASSIFLLAVSLNFQAATMTFFSI 110 + PSA TPLP GFL +SSSIV+ASPPAS IF LAVSLNF AATMTFFS Sbjct: 1 MSPSALIILITHHSIIITPLPLGFLSMSSSIVIASPPASVIFFLAVSLNFHAATMTFFSN 60 Query: 111 LPAPRTLPGTTIMSPSFAYLFILLTFTSALCLLGLSSLQAMSFHILTFSSLDFFLR 166 LPAPRTLPGTTI+SPS AYL ILLTFTSALCLLGLSSLQA SF I T SSLDFFLR Sbjct: 61 LPAPRTLPGTTIISPSLAYLLILLTFTSALCLLGLSSLQAKSFQIFTPSSLDFFLR 116 >pir||E72557 hypothetical protein APE1745 - Aeropyrum pernix (strain K1) >gi|5105433|dbj|BAA80746.1| (AP000062) 132aa long hypothetical protein [Aeropyrum pernix] Length = 132 Score = 85.0 bits (207), Expect = 4e-16 Identities = 50/81 (61%), Positives = 54/81 (65%) Query: 70 LPFGFLLISSSIVMASPPASSIFLLAVSLNFQAATMTFFSILPAPRTLPGTTIMSPSFAY 129 LP GF L +SS VMA P S I A LN +AAT+TFFS PAPRTLPGT +SPS A Sbjct: 5 LPRGFSLTASSRVMALEPESLILTSACRLNERAATVTFFSKAPAPRTLPGTMTISPSLAC 64 Query: 130 LFILLTFTSALCLLGLSSLQA 150 LFILL TSAL L GLS A Sbjct: 65 LFILLRLTSALLLRGLSRSSA 85 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.331 0.141 0.404 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42817464 Number of Sequences: 2977 Number of extensions: 1328047 Number of successful extensions: 4940 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4938 Number of HSP's gapped (non-prelim): 2 length of query: 166 length of database: 189,106,746 effective HSP length: 53 effective length of query: 113 effective length of database: 157,386,935 effective search space: 17784723655 effective search space used: 17784723655 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 162 (67.5 bits)