BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2017 494819 494463 -119 !not a gene! (119 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71045 hypothetical protein PH1652 - Pyrococcus horikoshii ... 96 2e-19 >pir||D71045 hypothetical protein PH1652 - Pyrococcus horikoshii >gi|3258081|dbj|BAA30764.1| (AP000006) 102aa long hypothetical protein [Pyrococcus horikoshii] Length = 102 Score = 95.6 bits (234), Expect = 2e-19 Identities = 46/72 (63%), Positives = 56/72 (76%) Query: 3 IAVKREIQNIKDRLPKISPSIIPRTAPKRRAWKVACVRKAIPFRFIKGLSRPSKVPTIKL 62 +A+KR+IQNIK+R P I+P IIP+TAP +AW VA VRKA P I+GLS P+ V TIKL Sbjct: 5 MAIKRDIQNIKERSPMINPRIIPKTAPNNKAWNVAWVRKATPLTLIRGLSNPNSVLTIKL 64 Query: 63 ARNALRRYSSIM 74 A ALRRYSSI+ Sbjct: 65 ANRALRRYSSII 76 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.139 0.421 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45026688 Number of Sequences: 2977 Number of extensions: 1728127 Number of successful extensions: 3344 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3343 Number of HSP's gapped (non-prelim): 1 length of query: 119 length of database: 189,106,746 effective HSP length: 50 effective length of query: 69 effective length of database: 159,182,396 effective search space: 10983585324 effective search space used: 10983585324 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 160 (66.7 bits)