BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2033 465448 465140 -103 !not a gene! (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||S75396 hypothetical protein c04030 - Sulfolobus solfataricu... 80 5e-15 >pir||S75396 hypothetical protein c04030 - Sulfolobus solfataricus >gi|1707802|emb|CAA69559.1| (Y08257) orf c04030 [Sulfolobus solfataricus] Length = 186 Score = 80.4 bits (195), Expect = 5e-15 Identities = 52/96 (54%), Positives = 60/96 (62%), Gaps = 2/96 (2%) Query: 7 STSMGTGSATKKYLFAIGSTSFLFIAAKLSQLTVASLFFSPTSIINSFMASGSIPLLLRA 66 ST + S T L A GS+ FL IAA S+L VAS+ F+PTSII S + SG IPLLL Sbjct: 62 STLNSSASFTNIILLATGSSFFLLIAAMFSKLIVASVTFTPTSIITSLIVSGKIPLLLSP 121 Query: 67 LIVPNLGSSQPRYLPSSIPFLVFDLLSITPSMLSLP 102 V NLGSS +P S L+FDLL I PS LSLP Sbjct: 122 AKVGNLGSS--LLVPFSNIPLIFDLLIIKPSSLSLP 155 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.134 0.379 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34236642 Number of Sequences: 2977 Number of extensions: 1221073 Number of successful extensions: 3418 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3416 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 189,106,746 effective HSP length: 54 effective length of query: 49 effective length of database: 156,788,448 effective search space: 7682633952 effective search space used: 7682633952 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)