BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2054 427682 427368 -105 !not a gene! (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D72626 hypothetical protein APE1468 - Aeropyrum pernix (str... 71 4e-12 >pir||D72626 hypothetical protein APE1468 - Aeropyrum pernix (strain K1) >gi|5105152|dbj|BAA80466.1| (AP000061) 138aa long hypothetical protein [Aeropyrum pernix] Length = 138 Score = 70.6 bits (170), Expect = 4e-12 Identities = 42/97 (43%), Positives = 52/97 (53%), Gaps = 7/97 (7%) Query: 1 MVTPFTPLGSPTITYSGLGT--SRALAPLENPSSSTKPANITFALLSTI-----ANSSAD 53 M TP P+GSPTI + G+ +R AP +PSS T P ++ + A Sbjct: 1 MATPSPPVGSPTIMWRGVSPLETRLQAPGLSPSSPTSPRTAELQERPSLDARWSPSIMAA 60 Query: 54 KGPLASTLPRPQSISPSILTGMYPGTVSTCPASKIRG 90 +GPLAST PRPQS+ PS L PGTVS CP S G Sbjct: 61 RGPLASTAPRPQSVYPSSLASSLPGTVSRCPTSPTTG 97 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.310 0.127 0.357 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34094739 Number of Sequences: 2977 Number of extensions: 1218549 Number of successful extensions: 3762 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3761 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 57 effective length of query: 48 effective length of database: 154,992,987 effective search space: 7439663376 effective search space used: 7439663376 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 159 (66.3 bits)