BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2058 418415 418002 -138 !not a gene! (138 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71181 hypothetical protein PH1728 - Pyrococcus horikoshii ... 128 3e-29 >pir||C71181 hypothetical protein PH1728 - Pyrococcus horikoshii >gi|3258159|dbj|BAA30842.1| (AP000007) 173aa long hypothetical protein [Pyrococcus horikoshii] Length = 173 Score = 128 bits (318), Expect = 3e-29 Identities = 77/127 (60%), Positives = 85/127 (66%) Query: 1 MGVDSVTGVATLELTMLIDFTKKYWPSIVPSNVITNIRPRSLILSFLTSWDILGSRKVVP 60 +GVDSVTGVAT+ELT LIDF K+Y P+IVP+ ITN RP S L+FL S ILG P Sbjct: 45 IGVDSVTGVATVELTKLIDFMKRYCPTIVPNREITNTRPISPSLNFLISLHILGKNGKPP 104 Query: 61 RAPDAILSPVIKTADSSLTSQSVIKTANVHISSATMTRPTPLRLISELSLPSLKRIITAR 120 R P+ IL IKT S LTSQSVI A VH SSAT T TPL LI SL SLKR TA Sbjct: 105 RIPELILKAAIKTGGSLLTSQSVINMAIVHKSSATTTSRTPLALIPPDSLFSLKRRRTAS 164 Query: 121 TIKIAPK 127 IK AP+ Sbjct: 165 IIKPAPR 171 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.132 0.364 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43268680 Number of Sequences: 2977 Number of extensions: 1472275 Number of successful extensions: 3976 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3975 Number of HSP's gapped (non-prelim): 1 length of query: 138 length of database: 189,106,746 effective HSP length: 58 effective length of query: 80 effective length of database: 154,394,500 effective search space: 12351560000 effective search space used: 12351560000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)