BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2061 (SRP19) DE:signal recognition particle, subunit SRP19, putative (99 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75158 probable signal recognition particle, chain srp19 PA... 194 2e-49 pir||C71198 hypothetical protein PHS054 - Pyrococcus horikoshii ... 156 4e-38 >pir||G75158 probable signal recognition particle, chain srp19 PAB2061 - Pyrococcus abyssi (strain Orsay) >gi|5457860|emb|CAB49350.1| (AJ248284) signal recognition particle, subunit SRP19, putative [Pyrococcus abyssi] Length = 99 Score = 194 bits (488), Expect = 2e-49 Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MSKFVIWTSELDSRLSKKYGRVVPRNLAVERPSIEEIEEAAKSLGFKVLQVEREKLNPKL 60 MSKFVIWTSELDSRLSKKYGRVVPRNLAVERPSIEEIEEAAKSLGFKVLQVEREKLNPKL Sbjct: 1 MSKFVIWTSELDSRLSKKYGRVVPRNLAVERPSIEEIEEAAKSLGFKVLQVEREKLNPKL 60 Query: 61 SGIDEDLRTYGRIIIESPYGKAKTLKIIAQKIRELRRRR 99 SGIDEDLRTYGRIIIESPYGKAKTLKIIAQKIRELRRRR Sbjct: 61 SGIDEDLRTYGRIIIESPYGKAKTLKIIAQKIRELRRRR 99 >pir||C71198 hypothetical protein PHS054 - Pyrococcus horikoshii >gi|3258295|dbj|BAA30978.1| (AP000007) 99aa long hypothetical protein [Pyrococcus horikoshii] Length = 99 Score = 156 bits (391), Expect = 4e-38 Identities = 70/99 (70%), Positives = 90/99 (90%) Query: 1 MSKFVIWTSELDSRLSKKYGRVVPRNLAVERPSIEEIEEAAKSLGFKVLQVEREKLNPKL 60 M +FV+W ELDSRLS+KYGR++P+NLA+E+PS++EI E A++L K+++V+REKLNP+L Sbjct: 1 MGRFVVWPCELDSRLSRKYGRIIPKNLAIEKPSLDEIIEVAETLNLKIVEVDREKLNPRL 60 Query: 61 SGIDEDLRTYGRIIIESPYGKAKTLKIIAQKIRELRRRR 99 SGIDE+LRTYGRIIIESPYGK KTL++IAQKIRE RRRR Sbjct: 61 SGIDEELRTYGRIIIESPYGKVKTLRLIAQKIREFRRRR 99 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.136 0.368 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32480372 Number of Sequences: 2977 Number of extensions: 1114934 Number of successful extensions: 4021 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4019 Number of HSP's gapped (non-prelim): 2 length of query: 99 length of database: 189,106,746 effective HSP length: 56 effective length of query: 43 effective length of database: 155,591,474 effective search space: 6690433382 effective search space used: 6690433382 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 158 (66.0 bits)