BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2064 (PAB2064) DE:Hypothetical protein (141 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75158 hypothetical protein PAB2064 - Pyrococcus abyssi (st... 285 1e-76 pir||H71197 hypothetical protein PH1854 - Pyrococcus horikoshii ... 180 9e-45 >pir||D75158 hypothetical protein PAB2064 - Pyrococcus abyssi (strain Orsay) >gi|5457857|emb|CAB49347.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 141 Score = 285 bits (722), Expect = 1e-76 Identities = 141/141 (100%), Positives = 141/141 (100%) Query: 1 MLSRLENIVSAVNKLNSITDEDIIMAVRKMKGRITCPYCKSPNIVKIGYIMRSGNFKIQR 60 MLSRLENIVSAVNKLNSITDEDIIMAVRKMKGRITCPYCKSPNIVKIGYIMRSGNFKIQR Sbjct: 1 MLSRLENIVSAVNKLNSITDEDIIMAVRKMKGRITCPYCKSPNIVKIGYIMRSGNFKIQR 60 Query: 61 YKCKNCNRTFTELDGTPLKGAHSLKDIVIVAYLTLDLKLPPSSIAKILPINRPKLYRAYK 120 YKCKNCNRTFTELDGTPLKGAHSLKDIVIVAYLTLDLKLPPSSIAKILPINRPKLYRAYK Sbjct: 61 YKCKNCNRTFTELDGTPLKGAHSLKDIVIVAYLTLDLKLPPSSIAKILPINRPKLYRAYK 120 Query: 121 RVITNKEFFRKLIYILLKDES 141 RVITNKEFFRKLIYILLKDES Sbjct: 121 RVITNKEFFRKLIYILLKDES 141 >pir||H71197 hypothetical protein PH1854 - Pyrococcus horikoshii >gi|3258292|dbj|BAA30975.1| (AP000007) 140aa long hypothetical protein [Pyrococcus horikoshii] Length = 140 Score = 180 bits (451), Expect = 9e-45 Identities = 81/140 (57%), Positives = 110/140 (77%) Query: 1 MLSRLENIVSAVNKLNSITDEDIIMAVRKMKGRITCPYCKSPNIVKIGYIMRSGNFKIQR 60 M RL+ I +NKL SI +EDII A+RK+ ++TCPYC S ++VKIG+I R N KIQR Sbjct: 1 MKGRLKEITEEINKLTSIPNEDIISAIRKINKKVTCPYCNSDHVVKIGFIYRRNNIKIQR 60 Query: 61 YKCKNCNRTFTELDGTPLKGAHSLKDIVIVAYLTLDLKLPPSSIAKILPINRPKLYRAYK 120 +KC+ C +TF+ELDGTPLKG HSLKDI++VAYL L L +PPSSI+++L INR ++YR Y+ Sbjct: 61 FKCQKCGKTFSELDGTPLKGVHSLKDIILVAYLVLMLGMPPSSISRVLGINRSRVYRMYE 120 Query: 121 RVITNKEFFRKLIYILLKDE 140 R+ +K+FFR+L+ ILL D+ Sbjct: 121 RITGHKKFFRELLNILLDDQ 140 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.141 0.404 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49106162 Number of Sequences: 2977 Number of extensions: 1929193 Number of successful extensions: 5802 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5800 Number of HSP's gapped (non-prelim): 2 length of query: 141 length of database: 189,106,746 effective HSP length: 52 effective length of query: 89 effective length of database: 157,985,422 effective search space: 14060702558 effective search space used: 14060702558 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 161 (67.1 bits)