BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2079 (PAB2079) DE:Hypothetical protein (123 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75155 hypothetical protein PAB2079 - Pyrococcus abyssi (st... 246 8e-65 sp|Q58521|YB21_METJA HYPOTHETICAL PROTEIN MJ1121 >gi|2128678|pir... 85 4e-16 gi|11499578 virulence associated protein C (vapC-1) [Archaeoglob... 68 5e-11 >pir||F75155 hypothetical protein PAB2079 - Pyrococcus abyssi (strain Orsay) >gi|5457835|emb|CAB49325.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 123 Score = 246 bits (621), Expect = 8e-65 Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MDKLLDTSVLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVN 60 MDKLLDTSVLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVN Sbjct: 1 MDKLLDTSVLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVN 60 Query: 61 FDKTSAEVAGEIFKDLISKGLRPPTKDLLIAATAIAHNIPLYTCDRGFERFKEYGLKLVI 120 FDKTSAEVAGEIFKDLISKGLRPPTKDLLIAATAIAHNIPLYTCDRGFERFKEYGLKLVI Sbjct: 61 FDKTSAEVAGEIFKDLISKGLRPPTKDLLIAATAIAHNIPLYTCDRGFERFKEYGLKLVI 120 Query: 121 LER 123 LER Sbjct: 121 LER 123 >sp|Q58521|YB21_METJA HYPOTHETICAL PROTEIN MJ1121 >gi|2128678|pir||H64439 hypothetical protein MJ1121 - Methanococcus jannaschii >gi|1499973|gb|AAB99123.1| (U67555) virulence associated protein C (vapC) [Methanococcus jannaschii] Length = 94 Score = 84.7 bits (206), Expect = 4e-16 Identities = 43/92 (46%), Positives = 61/92 (65%), Gaps = 1/92 (1%) Query: 1 MDKLLDTSVLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVN 60 MD ++DTSV+IE+FRGN L Q+ + I SI +FEL CG LK + + ++ +P +N Sbjct: 1 MDAVIDTSVIIEIFRGNKDTLYQIC-DYNCKITSITVFELYCGNLKENEMIMIDSLPKLN 59 Query: 61 FDKTSAEVAGEIFKDLISKGLRPPTKDLLIAA 92 FD S+++AG IFK L +G P KDLLIA+ Sbjct: 60 FDDKSSKIAGNIFKKLKKEGKIPSVKDLLIAS 91 >gi|11499578 virulence associated protein C (vapC-1) [Archaeoglobus fulgidus] >gi|3123137|sp|O28283|YJ96_ARCFU HYPOTHETICAL PROTEIN AF1996 >gi|7448927|pir||C69499 virulence associated protein C (vapC-1) homolog - Archaeoglobus fulgidus >gi|2648548|gb|AAB89263.1| (AE000965) virulence associated protein C (vapC-1) [Archaeoglobus fulgidus] Length = 84 Score = 67.5 bits (162), Expect = 5e-11 Identities = 30/68 (44%), Positives = 51/68 (74%) Query: 9 VLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVNFDKTSAEV 68 V+I++F+G+ +L +L + Y I I LFEL CG LK ++ + LEK+P +NF+++SA++ Sbjct: 9 VIIDLFKGDKGLLEKLNGDTVYGISVITLFELQCGSLKEREEIFLEKIPKLNFEESSAKL 68 Query: 69 AGEIFKDL 76 AG+IF++L Sbjct: 69 AGKIFREL 76 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.143 0.405 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45130722 Number of Sequences: 2977 Number of extensions: 1695298 Number of successful extensions: 3195 Number of sequences better than 1.0e-10: 3 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3192 Number of HSP's gapped (non-prelim): 3 length of query: 123 length of database: 189,106,746 effective HSP length: 52 effective length of query: 71 effective length of database: 157,985,422 effective search space: 11216964962 effective search space used: 11216964962 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)