BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2093 374280 373813 -156 !not a gene! (156 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71194 hypothetical protein PH1828 - Pyrococcus horikoshii ... 132 1e-30 >pir||D71194 hypothetical protein PH1828 - Pyrococcus horikoshii >gi|3258264|dbj|BAA30947.1| (AP000007) 115aa long hypothetical protein [Pyrococcus horikoshii] Length = 115 Score = 132 bits (330), Expect = 1e-30 Identities = 70/113 (61%), Positives = 82/113 (71%) Query: 44 PVTSANLLASLMRVSKVGFAKRFSNDFCPSTFIFSTTSLSKTSRVLNLPREIVNTLKPST 103 PV++A L AS + VS +G +FS+ P+ FIFSTTSLSKT V + P EIV TL PST Sbjct: 3 PVSTAKLRASFINVSGLGSLSKFSSACFPAIFIFSTTSLSKTFLVSSFPIEIVRTLNPST 62 Query: 104 IKLSTMATPGPPSFILTSTPPANWATISPNPPLFKTSASWATFAADNKVLLNL 156 LST ATPGPPSFIL S PPANWATISP+PPL+ TSASWA A+ +V NL Sbjct: 63 SILSTTATPGPPSFILISIPPANWATISPSPPLWITSASWAILEAERRVPPNL 115 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.129 0.374 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51858715 Number of Sequences: 2977 Number of extensions: 1845850 Number of successful extensions: 6842 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6841 Number of HSP's gapped (non-prelim): 1 length of query: 156 length of database: 189,106,746 effective HSP length: 57 effective length of query: 99 effective length of database: 154,992,987 effective search space: 15344305713 effective search space used: 15344305713 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)