BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2111 (PAB2111) DE:Hypothetical protein (123 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75149 hypothetical protein PAB2111 - Pyrococcus abyssi (st... 242 2e-63 pir||C71190 hypothetical protein PH1795 - Pyrococcus horikoshii ... 148 2e-35 >pir||H75149 hypothetical protein PAB2111 - Pyrococcus abyssi (strain Orsay) >gi|5457789|emb|CAB49279.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 123 Score = 242 bits (610), Expect = 2e-63 Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MERIGKRYVFLIFAVFFVGTLLSLTEYYSPLMATALAFGSTVLAILVPWAIISIVSKKEF 60 MERIGKRYVFLIFAVFFVGTLLSLTEYYSPLMATALAFGSTVLAILVPWAIISIVSKKEF Sbjct: 1 MERIGKRYVFLIFAVFFVGTLLSLTEYYSPLMATALAFGSTVLAILVPWAIISIVSKKEF 60 Query: 61 KYSTMLAFLLASLWEFLCSYLAMIIGYPLWKLFLNAGIGGIIVTVGIGISTITKAKVVLS 120 KYSTMLAFLLASLWEFLCSYLAMIIGYPLWKLFLNAGIGGIIVTVGIGISTITKAKVVLS Sbjct: 61 KYSTMLAFLLASLWEFLCSYLAMIIGYPLWKLFLNAGIGGIIVTVGIGISTITKAKVVLS 120 Query: 121 EVK 123 EVK Sbjct: 121 EVK 123 >pir||C71190 hypothetical protein PH1795 - Pyrococcus horikoshii >gi|3258231|dbj|BAA30914.1| (AP000007) 123aa long hypothetical protein [Pyrococcus horikoshii] Length = 123 Score = 148 bits (370), Expect = 2e-35 Identities = 74/123 (60%), Positives = 92/123 (74%) Query: 1 MERIGKRYVFLIFAVFFVGTLLSLTEYYSPLMATALAFGSTVLAILVPWAIISIVSKKEF 60 M+ IGK+Y+ I +F +G +SL E YS +A ALA STVLAILVPW II VSK++F Sbjct: 1 MKEIGKKYISAISFIFLIGISISLAENYSLPIAVALALVSTVLAILVPWIIIFRVSKRKF 60 Query: 61 KYSTMLAFLLASLWEFLCSYLAMIIGYPLWKLFLNAGIGGIIVTVGIGISTITKAKVVLS 120 ++S LAFLLASLWEF CSYL +++GYPLWK+F NAGIGGI+VT I I + KAK V + Sbjct: 61 RHSIFLAFLLASLWEFFCSYLTLMLGYPLWKIFFNAGIGGIVVTAIIAIGGMIKAKGVSA 120 Query: 121 EVK 123 EVK Sbjct: 121 EVK 123 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.144 0.426 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38334183 Number of Sequences: 2977 Number of extensions: 1275156 Number of successful extensions: 5808 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5806 Number of HSP's gapped (non-prelim): 2 length of query: 123 length of database: 189,106,746 effective HSP length: 49 effective length of query: 74 effective length of database: 159,780,883 effective search space: 11823785342 effective search space used: 11823785342 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 160 (66.7 bits)