BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2117 (PAB2117) DE:Hypothetical protein (137 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75148 hypothetical protein PAB2117 - Pyrococcus abyssi (st... 270 4e-72 pir||D71188 hypothetical protein PH1781 - Pyrococcus horikoshii ... 219 1e-56 >pir||D75148 hypothetical protein PAB2117 - Pyrococcus abyssi (strain Orsay) >gi|5457777|emb|CAB49267.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 137 Score = 270 bits (684), Expect = 4e-72 Identities = 137/137 (100%), Positives = 137/137 (100%) Query: 1 MIEVGLFDKLKKGEPQKKMPSILKDKVKQVEKSPEEVELVPVEEDTLAREILKPKVTYIK 60 MIEVGLFDKLKKGEPQKKMPSILKDKVKQVEKSPEEVELVPVEEDTLAREILKPKVTYIK Sbjct: 1 MIEVGLFDKLKKGEPQKKMPSILKDKVKQVEKSPEEVELVPVEEDTLAREILKPKVTYIK 60 Query: 61 KISISTYADLKNVSEEISAGNIVIADLTPLEPKPDLLSKVAEQLRMTAETFGWDIAKLCK 120 KISISTYADLKNVSEEISAGNIVIADLTPLEPKPDLLSKVAEQLRMTAETFGWDIAKLCK Sbjct: 61 KISISTYADLKNVSEEISAGNIVIADLTPLEPKPDLLSKVAEQLRMTAETFGWDIAKLCK 120 Query: 121 NESKVIITPPNIKIFKE 137 NESKVIITPPNIKIFKE Sbjct: 121 NESKVIITPPNIKIFKE 137 >pir||D71188 hypothetical protein PH1781 - Pyrococcus horikoshii >gi|3258216|dbj|BAA30899.1| (AP000007) 134aa long hypothetical protein [Pyrococcus horikoshii] Length = 134 Score = 219 bits (551), Expect = 1e-56 Identities = 110/137 (80%), Positives = 123/137 (89%), Gaps = 3/137 (2%) Query: 1 MIEVGLFDKLKKGEPQKKMPSILKDKVKQVEKSPEEVELVPVEEDTLAREILKPKVTYIK 60 M++VGLFDKLKK + Q+K LK+KVK+ P EVELVPVEED L +EI+KPKVTYIK Sbjct: 1 MVKVGLFDKLKKSDTQRKALPSLKEKVKE---EPSEVELVPVEEDKLVKEIIKPKVTYIK 57 Query: 61 KISISTYADLKNVSEEISAGNIVIADLTPLEPKPDLLSKVAEQLRMTAETFGWDIAKLCK 120 K+SISTYADLKNVSEEISAGNIVIADLTPLE KP+LL+KVAEQLRMTAETFGWDIAKLCK Sbjct: 58 KVSISTYADLKNVSEEISAGNIVIADLTPLESKPELLTKVAEQLRMTAETFGWDIAKLCK 117 Query: 121 NESKVIITPPNIKIFKE 137 NESKVIITPPNI+IF+E Sbjct: 118 NESKVIITPPNIRIFRE 134 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.311 0.133 0.358 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48693414 Number of Sequences: 2977 Number of extensions: 1861435 Number of successful extensions: 6145 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6142 Number of HSP's gapped (non-prelim): 2 length of query: 137 length of database: 189,106,746 effective HSP length: 59 effective length of query: 78 effective length of database: 153,796,013 effective search space: 11996089014 effective search space used: 11996089014 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 160 (66.7 bits)