BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2216 207600 206812 -263 !not a gene! (263 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||B71245 hypothetical protein PH0220 - Pyrococcus horikoshii ... 243 2e-63 >pir||B71245 hypothetical protein PH0220 - Pyrococcus horikoshii >gi|3256606|dbj|BAA29289.1| (AP000001) 171aa long hypothetical protein [Pyrococcus horikoshii] Length = 171 Score = 243 bits (613), Expect = 2e-63 Identities = 121/138 (87%), Positives = 121/138 (87%) Query: 75 TLLSPPGFRLFSPPSRGAFQLSLTVLVRYRSRDVFRVGSRCLPASRRISNRRYSGSPETL 134 TLLSPPGFRLFSPPSRGAFQLSLTVLVRYRSRDVFRVGSRCLPASRRISNRRYSGSPETL Sbjct: 27 TLLSPPGFRLFSPPSRGAFQLSLTVLVRYRSRDVFRVGSRCLPASRRISNRRYSGSPETL 86 Query: 135 RAYAYGAITLSGAAFQRTSASPARVSYGGPTTPHPPNLVGPGFSLPCAAFGRPYSXXXXX 194 RAYAYGAITLSGAAFQRTSASPARVSYGGPTTPHPPNLVGPGFSLP A FGRPYS Sbjct: 87 RAYAYGAITLSGAAFQRTSASPARVSYGGPTTPHPPNLVGPGFSLPSAVFGRPYSRHRFC 146 Query: 195 XXXXXXXXXXNSPRSPSG 212 NSPRSPSG Sbjct: 147 FLFLRVLRCFNSPRSPSG 164 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.135 0.421 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93417431 Number of Sequences: 2977 Number of extensions: 3687603 Number of successful extensions: 8662 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8660 Number of HSP's gapped (non-prelim): 1 length of query: 263 length of database: 189,106,746 effective HSP length: 52 effective length of query: 211 effective length of database: 157,985,422 effective search space: 33334924042 effective search space used: 33334924042 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 164 (68.3 bits)