BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2217 207259 206597 -221 !not a gene! (221 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71245 hypothetical protein PH0219 - Pyrococcus horikoshii ... 199 2e-50 >pir||A71245 hypothetical protein PH0219 - Pyrococcus horikoshii >gi|3256605|dbj|BAA29288.1| (AP000001) 125aa long hypothetical protein [Pyrococcus horikoshii] Length = 125 Score = 199 bits (502), Expect = 2e-50 Identities = 92/118 (77%), Positives = 93/118 (77%) Query: 104 VRHKPREVPFGNPRFDGCLRLAGXXXXXXXXXXXXXXXXXTGRLSVLTPYRRGQALLGPP 163 +RHKPREVPFGNPRFDGCLRLAG TGRL VLTPYRRGQALLGPP Sbjct: 1 MRHKPREVPFGNPRFDGCLRLAGAYRSLPRPSSAPRAEPSTGRLRVLTPYRRGQALLGPP 60 Query: 164 AYARXXXXXXIRGPWALPSRAGLGTCISSWWTGRDLNPGPPPCKGGAHTRLSYRPTKK 221 AYAR IRGPWALPSRAGLGTCISSWWTGRDLNPGPPPCKGGAHTRLSYRPT K Sbjct: 61 AYARPSSSPPIRGPWALPSRAGLGTCISSWWTGRDLNPGPPPCKGGAHTRLSYRPTNK 118 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.146 0.494 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94203391 Number of Sequences: 2977 Number of extensions: 4019247 Number of successful extensions: 10540 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10539 Number of HSP's gapped (non-prelim): 1 length of query: 221 length of database: 189,106,746 effective HSP length: 44 effective length of query: 177 effective length of database: 162,773,318 effective search space: 28810877286 effective search space used: 28810877286 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 164 (68.3 bits)