BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2219 205513 205151 -121 !not a gene! (121 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71244 hypothetical protein PH0217 - Pyrococcus horikoshii ... 232 1e-60 emb|CAC12547.1| (AL445067) conserved hypothetical protein [Therm... 75 5e-13 >pir||G71244 hypothetical protein PH0217 - Pyrococcus horikoshii >gi|3256603|dbj|BAA29286.1| (AP000001) 106aa long hypothetical protein [Pyrococcus horikoshii] Length = 106 Score = 232 bits (586), Expect = 1e-60 Identities = 105/106 (99%), Positives = 106/106 (99%) Query: 16 VPEARHWGSPRRGFPHCGGFAPAAPRRAWTRVSVSISGLPLSRPVPIFGLVGRYPTNYLI 75 +PEARHWGSPRRGFPHCGGFAPAAPRRAWTRVSVSISGLPLSRPVPIFGLVGRYPTNYLI Sbjct: 1 MPEARHWGSPRRGFPHCGGFAPAAPRRAWTRVSVSISGLPLSRPVPIFGLVGRYPTNYLI 60 Query: 76 GRRPILGRSLTAPFRPGDLPVPQAYGGLAPVSRGYPPPEGRLPTCY 121 GRRPILGRSLTAPFRPGDLPVPQAYGGLAPVSRGYPPPEGRLPTCY Sbjct: 61 GRRPILGRSLTAPFRPGDLPVPQAYGGLAPVSRGYPPPEGRLPTCY 106 >emb|CAC12547.1| (AL445067) conserved hypothetical protein [Thermoplasma acidophilum] Length = 81 Score = 74.5 bits (180), Expect = 5e-13 Identities = 36/56 (64%), Positives = 39/56 (69%) Query: 9 FLHSGKAVPEARHWGSPRRGFPHCGGFAPAAPRRAWTRVSVSISGLPLSRPVPIFG 64 F H ++RH GSP R F HC FAPAAPRRAWT VS SISGLPLS PVP+ G Sbjct: 26 FRHQKSLDKKSRHSGSPCRAFAHCTVFAPAAPRRAWTVVSESISGLPLSGPVPVLG 81 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.145 0.487 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59477438 Number of Sequences: 2977 Number of extensions: 2910178 Number of successful extensions: 5943 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5941 Number of HSP's gapped (non-prelim): 2 length of query: 121 length of database: 189,106,746 effective HSP length: 43 effective length of query: 78 effective length of database: 163,371,805 effective search space: 12743000790 effective search space used: 12743000790 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)