BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2249 157842 157528 -105 !not a gene! (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71237 hypothetical protein PH0158 - Pyrococcus horikoshii ... 125 2e-28 >pir||D71237 hypothetical protein PH0158 - Pyrococcus horikoshii >gi|3256544|dbj|BAA29227.1| (AP000001) 106aa long hypothetical protein [Pyrococcus horikoshii] Length = 106 Score = 125 bits (310), Expect = 2e-28 Identities = 65/105 (61%), Positives = 77/105 (72%) Query: 1 MKALSVIPPIFKLTLTRGPSSSIPITSALNSFLAEVLTGSVDRIMSSGLTPILTFPSTLM 60 MKAL +IPP +++LT+ P SSIP T AL +FLAEVLT S+ ++SSGL P LT P T + Sbjct: 2 MKALKIIPPRLRVSLTKAPKSSIPSTLALKTFLAEVLTPSMKMVISSGLIPTLTLPHTSL 61 Query: 61 GRVILTPLASKMLPLATPSIMFSKPKNLATPSSTGFEKTSLTSPT 105 G IL K+LP ATPSIMFSKP+NLAT S G EKTSLTSPT Sbjct: 62 GSSILRSPTFKILPFATPSIMFSKPRNLATSSLLGLEKTSLTSPT 106 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.130 0.355 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34876379 Number of Sequences: 2977 Number of extensions: 1183471 Number of successful extensions: 4358 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4357 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 58 effective length of query: 47 effective length of database: 154,394,500 effective search space: 7256541500 effective search space used: 7256541500 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 159 (66.3 bits)