BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2298 (PAB2298) DE:Hypothetical protein (134 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C75193 hypothetical protein PAB2298 - Pyrococcus abyssi (st... 274 3e-73 pir||D71225 hypothetical protein PH0062 - Pyrococcus horikoshii ... 232 2e-60 >pir||C75193 hypothetical protein PAB2298 - Pyrococcus abyssi (strain Orsay) >gi|5457503|emb|CAB48994.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 134 Score = 274 bits (693), Expect = 3e-73 Identities = 134/134 (100%), Positives = 134/134 (100%) Query: 1 MKLRELIESLSEKQKRTVKNCLDRCGIYDLEQEVDPYPREDVKRFLKVISNPIRYGILKM 60 MKLRELIESLSEKQKRTVKNCLDRCGIYDLEQEVDPYPREDVKRFLKVISNPIRYGILKM Sbjct: 1 MKLRELIESLSEKQKRTVKNCLDRCGIYDLEQEVDPYPREDVKRFLKVISNPIRYGILKM 60 Query: 61 LRDKWMCVCLISKALDVDQTLVSHHIRILKEAELLEERREGKLRFYRTNKEKFMEYLRAV 120 LRDKWMCVCLISKALDVDQTLVSHHIRILKEAELLEERREGKLRFYRTNKEKFMEYLRAV Sbjct: 61 LRDKWMCVCLISKALDVDQTLVSHHIRILKEAELLEERREGKLRFYRTNKEKFMEYLRAV 120 Query: 121 MEEIGYEGATGGSE 134 MEEIGYEGATGGSE Sbjct: 121 MEEIGYEGATGGSE 134 >pir||D71225 hypothetical protein PH0062 - Pyrococcus horikoshii >gi|3256448|dbj|BAA29131.1| (AP000001) 137aa long hypothetical protein [Pyrococcus horikoshii] Length = 137 Score = 232 bits (585), Expect = 2e-60 Identities = 107/128 (83%), Positives = 122/128 (94%) Query: 1 MKLRELIESLSEKQKRTVKNCLDRCGIYDLEQEVDPYPREDVKRFLKVISNPIRYGILKM 60 MKLREL+ESLSEKQ+RTV NCL+RCGIYDLE+EV+PYP+E+VKRFLKV+SNPIRYGI+KM Sbjct: 5 MKLRELVESLSEKQRRTVMNCLERCGIYDLEEEVNPYPKEEVKRFLKVVSNPIRYGIVKM 64 Query: 61 LRDKWMCVCLISKALDVDQTLVSHHIRILKEAELLEERREGKLRFYRTNKEKFMEYLRAV 120 L DKWMCVCLI+KALDVDQTLVSHHIRILKE +LLEE+REGKLRFYR NKEK MEY+R + Sbjct: 65 LIDKWMCVCLIAKALDVDQTLVSHHIRILKEIDLLEEKREGKLRFYRVNKEKLMEYMREM 124 Query: 121 MEEIGYEG 128 MEE+GYEG Sbjct: 125 MEELGYEG 132 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.140 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48098714 Number of Sequences: 2977 Number of extensions: 1754395 Number of successful extensions: 6069 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6067 Number of HSP's gapped (non-prelim): 2 length of query: 134 length of database: 189,106,746 effective HSP length: 53 effective length of query: 81 effective length of database: 157,386,935 effective search space: 12748341735 effective search space used: 12748341735 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)