BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2325 (PAB2325) DE:Hypothetical protein (146 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C75189 hypothetical protein PAB2325 - Pyrococcus abyssi (st... 297 5e-80 pir||G71158 hypothetical protein PH0469 - Pyrococcus horikoshii ... 166 2e-40 pir||F64509 conserved hypothetical protein MJ1680 - Methanococcu... 107 8e-23 gi|11497911 conserved hypothetical protein [Archaeoglobus fulgid... 89 2e-17 >pir||C75189 hypothetical protein PAB2325 - Pyrococcus abyssi (strain Orsay) >gi|5457471|emb|CAB48962.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 146 Score = 297 bits (752), Expect = 5e-80 Identities = 146/146 (100%), Positives = 146/146 (100%) Query: 1 MKLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKIALLAEEGKLNN 60 MKLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKIALLAEEGKLNN Sbjct: 1 MKLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKIALLAEEGKLNN 60 Query: 61 AWPRVLANFLYGTEIVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLRGLNK 120 AWPRVLANFLYGTEIVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLRGLNK Sbjct: 61 AWPRVLANFLYGTEIVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLRGLNK 120 Query: 121 TLRLKDHIVRILKPVEFIKEELRKEC 146 TLRLKDHIVRILKPVEFIKEELRKEC Sbjct: 121 TLRLKDHIVRILKPVEFIKEELRKEC 146 >pir||G71158 hypothetical protein PH0469 - Pyrococcus horikoshii >gi|3256873|dbj|BAA29556.1| (AP000002) 146aa long hypothetical protein [Pyrococcus horikoshii] Length = 146 Score = 166 bits (415), Expect = 2e-40 Identities = 81/146 (55%), Positives = 101/146 (68%) Query: 1 MKLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKIALLAEEGKLNN 60 M++VMDTNVVLA L+ P GL LLI LD + NYTS E LEEL KI LLAEEGKL++ Sbjct: 1 MRIVMDTNVVLAGLVNPNGLAALLILALDGEVLENYTSDEGLEELILKIGLLAEEGKLSS 60 Query: 61 AWPRVLANFLYGTEIVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLRGLNK 120 W +VL++F+ +++V P KFN+ D DDNKWL+IAY KA ILTWD+DLL LR N+ Sbjct: 61 EWKKVLSHFVANSKVVSPSRKFNLSRDPDDNKWLEIAYEVKAACILTWDQDLLDLRDENR 120 Query: 121 TLRLKDHIVRILKPVEFIKEELRKEC 146 LRL DH V +L P EF ++ C Sbjct: 121 VLRLDDHSVEVLTPSEFYHSVIKALC 146 >pir||F64509 conserved hypothetical protein MJ1680 - Methanococcus jannaschii >gi|1592247|gb|AAB99701.1| (U67608) conserved hypothetical protein [Methanococcus jannaschii] Length = 155 Score = 107 bits (264), Expect = 8e-23 Identities = 57/142 (40%), Positives = 91/142 (63%), Gaps = 3/142 (2%) Query: 1 MKLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKI--ALLAEEGKL 58 +K+V+DTNV ++ALI P G+ G ++ L+ ++ NYTSP L+E+ K L + Sbjct: 9 IKVVIDTNVFISALINPNGIPGKILDLIFEEKIVNYTSPSILKEIGFKCLSPKLRKYLGN 68 Query: 59 NNAWPRVLANFLYGTEIVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLRGL 118 N ++L F + I+ P FN+C DEDDNK++++AY +KA +I+T DKDL+SLR Sbjct: 69 ENRILKILTAFSSVSVIINPNTNFNVCRDEDDNKFINVAYESKA-IIITGDKDLISLRDE 127 Query: 119 NKTLRLKDHIVRILKPVEFIKE 140 NK L++ + +++ P EFI+E Sbjct: 128 NKYLKINNIHLKVPTPKEFIEE 149 >gi|11497911 conserved hypothetical protein [Archaeoglobus fulgidus] >gi|7429989|pir||H69286 conserved hypothetical protein AF0296 - Archaeoglobus fulgidus >gi|2650335|gb|AAB90932.1| (AE001084) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 157 Score = 89.3 bits (218), Expect = 2e-17 Identities = 57/143 (39%), Positives = 81/143 (55%), Gaps = 10/143 (6%) Query: 2 KLVMDTNVVLAALIRPEGLGGLLISLLDKQHFTNYTSPEALEELQAKIALLAEEGKLNNA 61 K+V+DT+V+ AALI +G LIS L N+ S E L+E + KL Sbjct: 3 KVVIDTSVIAAALISKKGGSYKLISHLIDNKLENHVSREILDEYFRVLIT-----KLTEF 57 Query: 62 WP-RVLANFLYGTE----IVEPREKFNICHDEDDNKWLDIAYAAKAYVILTWDKDLLSLR 116 +P VL F E + P E+F+IC D++DNK+L+ YA+KA ++T D DLL LR Sbjct: 58 FPVEVLLEFYVLLESKSKTINPNEQFDICRDKEDNKFLNTVYASKANFLITLDNDLLDLR 117 Query: 117 GLNKTLRLKDHIVRILKPVEFIK 139 N ++K+H +ILKP EF+K Sbjct: 118 DENWEYQIKEHKFKILKPEEFLK 140 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.139 0.409 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53913812 Number of Sequences: 2977 Number of extensions: 2062337 Number of successful extensions: 4341 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4335 Number of HSP's gapped (non-prelim): 4 length of query: 146 length of database: 189,106,746 effective HSP length: 52 effective length of query: 94 effective length of database: 157,985,422 effective search space: 14850629668 effective search space used: 14850629668 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 161 (67.1 bits)