BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2328 (PAB2328) DE:Hypothetical protein (101 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75188 hypothetical protein PAB2328 - Pyrococcus abyssi (st... 201 2e-51 sp|Q57682|Y229_METJA HYPOTHETICAL PROTEIN MJ0229 >gi|2128187|pir... 97 5e-20 >pir||G75188 hypothetical protein PAB2328 - Pyrococcus abyssi (strain Orsay) >gi|5457467|emb|CAB48958.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 101 Score = 201 bits (506), Expect = 2e-51 Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MVTMVQSIDELVKIGEALGNPVRVKILKMLCEKEWYVYELAKELGISRQLLYLHLKKLEK 60 MVTMVQSIDELVKIGEALGNPVRVKILKMLCEKEWYVYELAKELGISRQLLYLHLKKLEK Sbjct: 1 MVTMVQSIDELVKIGEALGNPVRVKILKMLCEKEWYVYELAKELGISRQLLYLHLKKLEK 60 Query: 61 AGLVESELRLEPGDPRAKKYYKAKQFKIVITNETLKNLKEV 101 AGLVESELRLEPGDPRAKKYYKAKQFKIVITNETLKNLKEV Sbjct: 61 AGLVESELRLEPGDPRAKKYYKAKQFKIVITNETLKNLKEV 101 >sp|Q57682|Y229_METJA HYPOTHETICAL PROTEIN MJ0229 >gi|2128187|pir||F64328 hypothetical protein MJ0229 - Methanococcus jannaschii >gi|1499006|gb|AAB98214.1| (U67478) arsenical resistance operon repressor [Methanococcus jannaschii] Length = 95 Score = 96.7 bits (237), Expect = 5e-20 Identities = 52/91 (57%), Positives = 68/91 (74%), Gaps = 2/91 (2%) Query: 10 ELVKIGEALGNPVRVKILKMLCEKEWYVYELAKELGISRQLLYLHLKKLEKAGLVESELR 69 ++VK+GEAL NP+RVKIL +L ++ +YELAKEL +SR ++Y HL+KLE A LVES+L Sbjct: 5 DVVKMGEALSNPIRVKILYILNKQPKNIYELAKELELSRPVVYAHLRKLEDADLVESDLV 64 Query: 70 LEPGDPRAKKYYKAKQFKIVITNETLKNLKE 100 LE RAK+ YKAK+FK I NE +K L E Sbjct: 65 LE--GSRAKRIYKAKEFKFYIDNEIIKKLFE 93 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.137 0.375 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34558695 Number of Sequences: 2977 Number of extensions: 1204263 Number of successful extensions: 4094 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4091 Number of HSP's gapped (non-prelim): 2 length of query: 101 length of database: 189,106,746 effective HSP length: 55 effective length of query: 46 effective length of database: 156,189,961 effective search space: 7184738206 effective search space used: 7184738206 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 159 (66.3 bits)