BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2362 879778 880260 161 !not a gene! (161 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71101 hypothetical protein PH1073 - Pyrococcus horikoshii ... 235 2e-61 >pir||F71101 hypothetical protein PH1073 - Pyrococcus horikoshii >gi|3257489|dbj|BAA30172.1| (AP000004) 215aa long hypothetical protein [Pyrococcus horikoshii] Length = 215 Score = 235 bits (594), Expect = 2e-61 Identities = 121/156 (77%), Positives = 133/156 (84%) Query: 2 PFLMSLPTGFPSFSSSAIKSRTSSHIWNAIPTFLPHLDRASMYSSFSVPTIPPTLAEASK 61 PFLMSLPTGFPSF SSAI+SRTSS IWNAIPTFLP L+RA +YSS SVP +PPT AEAS Sbjct: 60 PFLMSLPTGFPSFFSSAIRSRTSSQIWNAIPTFLPQLERAFIYSSLSVPIMPPTFAEASN 119 Query: 62 RAPVFPLIILMYSSMLTISLFSNSKSKACPSQSSFDALTIVSRTLAFFSGEISALDIASK 121 APVFPLII MYSS++T+ FSNS+S A PSQSSFDA TI S TLAFFSG ISAL ASK Sbjct: 120 NAPVFPLIISMYSSIVTVLFFSNSRSLAWPSQSSFDAFTITSNTLAFFSGGISALATASK 179 Query: 122 ALLNNKSPAKIAMFIPQTLCTVGFPLLVSSMSIMSS 157 ALL ++SPAKIAMF PQ LCTVGFPLLVSS+SI+SS Sbjct: 180 ALLKSRSPAKIAMFTPQILCTVGFPLLVSSISIISS 215 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.129 0.372 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52112362 Number of Sequences: 2977 Number of extensions: 1730516 Number of successful extensions: 4673 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4672 Number of HSP's gapped (non-prelim): 1 length of query: 161 length of database: 189,106,746 effective HSP length: 57 effective length of query: 104 effective length of database: 154,992,987 effective search space: 16119270648 effective search space used: 16119270648 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 162 (67.5 bits)