BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2384 1336543 1335965 -193 !not a gene! (193 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71111 hypothetical protein PH0659 - Pyrococcus horikoshii ... 88 8e-17 >pir||D71111 hypothetical protein PH0659 - Pyrococcus horikoshii >gi|3257067|dbj|BAA29750.1| (AP000003) 158aa long hypothetical protein [Pyrococcus horikoshii] Length = 158 Score = 87.8 bits (214), Expect = 8e-17 Identities = 58/159 (36%), Positives = 66/159 (41%), Gaps = 1/159 (0%) Query: 22 LVTSLFSSMPLLTSFFPFXXXXXXXXXXXXXXAIFXXXXXXXXXXXXXXXXXXXPFSLNS 81 ++TSL SS+P TS P AIF P S Sbjct: 1 MLTSLLSSIPFSTSSSPLSVISTFLITFSSSSAIFLLFNSLTEIIFSISSTETSPLDKTS 60 Query: 82 FKAISIGLSPSFSPFSVISRTNPFSSFLTFASPSLLRIPTIAXXXXXXXXXXXXXRYAFF 141 KAISI L +F PFS R P LT A PS L PT+A F Sbjct: 61 -KAISIALFSAFLPFSDNLRVRPSLVLLTSAHPSFLSTPTMAFSSSSLKTSFRSFNVTFP 119 Query: 142 FSLRTLSALISGRPILEYSFPMSVRTIIFSFLSCNFINP 180 FSLR +ALISG PI Y FP+SV II SC F +P Sbjct: 120 FSLRIFNALISGSPISIYLFPVSVNFIILLLSSCTFASP 158 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.139 0.398 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46199944 Number of Sequences: 2977 Number of extensions: 1226004 Number of successful extensions: 3162 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3160 Number of HSP's gapped (non-prelim): 1 length of query: 193 length of database: 189,106,746 effective HSP length: 54 effective length of query: 139 effective length of database: 156,788,448 effective search space: 21793594272 effective search space used: 21793594272 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 163 (67.9 bits)