BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2395 378437 378036 -134 !not a gene! (134 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71195 hypothetical protein PH1834 - Pyrococcus horikoshii ... 107 6e-23 >pir||C71195 hypothetical protein PH1834 - Pyrococcus horikoshii >gi|3258271|dbj|BAA30954.1| (AP000007) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 107 bits (264), Expect = 6e-23 Identities = 55/80 (68%), Positives = 64/80 (79%) Query: 1 MPLAIPLRISSLTSPGTAKEKKKAIGLPPIAAISLTFIVTTFLPASSGVMKSGTSVFQTS 60 +PLAIPL + S GT +EKK A G PPIAA+SLTFIVTTF PASSGV+KSGTSV TS Sbjct: 30 IPLAIPLNVFSSVFSGTPREKKNASGNPPIAAMSLTFIVTTFFPASSGVIKSGTSVLHTS 89 Query: 61 ISDVTSSQELLSLMNPASSP 80 +SDVT++QE L+L PASSP Sbjct: 90 MSDVTNNQESLNLTKPASSP 109 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.131 0.356 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43846266 Number of Sequences: 2977 Number of extensions: 1468147 Number of successful extensions: 3786 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3785 Number of HSP's gapped (non-prelim): 1 length of query: 134 length of database: 189,106,746 effective HSP length: 59 effective length of query: 75 effective length of database: 153,796,013 effective search space: 11534700975 effective search space used: 11534700975 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)