BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB2419 1046951 1047295 115 !not a gene! (115 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71057 hypothetical protein PH1158 - Pyrococcus horikoshii ... 149 7e-36 >pir||H71057 hypothetical protein PH1158 - Pyrococcus horikoshii >gi|3257575|dbj|BAA30258.1| (AP000005) 165aa long hypothetical protein [Pyrococcus horikoshii] Length = 165 Score = 149 bits (373), Expect = 7e-36 Identities = 81/115 (70%), Positives = 92/115 (79%) Query: 1 MLNSLAALKARTLAFSSSYSEESTPLVFPNSPRSDDISPKLPFNTVTPLSRISSATLVLS 60 +LNSLAA LA SS YS+ESTPLVFP+SP+ DISPKLPF+T TPL +IS TLVL+ Sbjct: 2 VLNSLAAFIVNFLASSSPYSKESTPLVFPSSPKRADISPKLPFSTSTPLLKISRETLVLN 61 Query: 61 FVAPAPTGSRTMGFFISLAISTAFIMDFLHQESRVPIFITTASANPIISSSSSSA 115 VAPAPTGS T+GF S AIS AF +D LH ESRVPIF+TTASA+ IISSSSSSA Sbjct: 62 LVAPAPTGSSTIGFPNSFAISVAFTIDLLHPESRVPIFMTTASASLIISSSSSSA 116 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.127 0.340 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36423257 Number of Sequences: 2977 Number of extensions: 1331131 Number of successful extensions: 3450 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3449 Number of HSP's gapped (non-prelim): 1 length of query: 115 length of database: 189,106,746 effective HSP length: 61 effective length of query: 54 effective length of database: 152,599,039 effective search space: 8240348106 effective search space used: 8240348106 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 159 (66.3 bits)