BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3009 (EF-1-BETA) DE:translation elongation factor EF-1, subunit beta (91 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75188 translation elongation factor ef-1, chain beta PAB30... 180 3e-45 sp|O27734|EF1B_METTH ELONGATION FACTOR 1-BETA (EF-1-BETA) >gi|74... 67 4e-11 >pir||A75188 translation elongation factor ef-1, chain beta PAB3009 - Pyrococcus abyssi (strain Orsay) >gi|5457461|emb|CAB48952.1| (AJ248283) translation elongation factor EF-1, subunit beta [Pyrococcus abyssi] Length = 91 Score = 180 bits (451), Expect = 3e-45 Identities = 91/91 (100%), Positives = 91/91 (100%) Query: 1 MSDFNIVGVIKVMPSDPEVNLDELEEKLKAVIPEKYGLAKVEREPIAFGLVALKFYVLGK 60 MSDFNIVGVIKVMPSDPEVNLDELEEKLKAVIPEKYGLAKVEREPIAFGLVALKFYVLGK Sbjct: 1 MSDFNIVGVIKVMPSDPEVNLDELEEKLKAVIPEKYGLAKVEREPIAFGLVALKFYVLGK 60 Query: 61 DEEGYSFDEVAEKFKEVENVESAEVETVSRI 91 DEEGYSFDEVAEKFKEVENVESAEVETVSRI Sbjct: 61 DEEGYSFDEVAEKFKEVENVESAEVETVSRI 91 >sp|O27734|EF1B_METTH ELONGATION FACTOR 1-BETA (EF-1-BETA) >gi|7450715|pir||B69094 conserved hypothetical protein MTH1699 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|10120770|pdb|1D5K|A Chain A, Solution Structure Of The Archaeal Translation Elongation Factor 1beta From Methanobacterium Thermoautotrophicum >gi|2622830|gb|AAB86171.1| (AE000927) translation elongation factor EF-1b [Methanobacterium thermoautotrophicum] Length = 89 Score = 66.7 bits (160), Expect = 4e-11 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 1/87 (1%) Query: 5 NIVGVIKVMPSDPEVNLDELEEKLKAVIPEKYGLAKVEREPIAFGLVALKFYVLGKDEEG 64 ++V IKVMP P+V+L+ L+++++ IPE L K++ EPIAFGLVAL V+ D EG Sbjct: 3 DVVATIKVMPESPDVDLEALKKEIQERIPEGTELHKIDEEPIAFGLVALNVMVVVGDAEG 62 Query: 65 YSFDEVAEKFKEVENVESAEVETVSRI 91 + E +E V + EV V R+ Sbjct: 63 -GTEAAEESLSGIEGVSNIEVTDVRRL 88 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.312 0.136 0.358 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31692642 Number of Sequences: 2977 Number of extensions: 1139296 Number of successful extensions: 2640 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2639 Number of HSP's gapped (non-prelim): 2 length of query: 91 length of database: 189,106,746 effective HSP length: 57 effective length of query: 34 effective length of database: 154,992,987 effective search space: 5269761558 effective search space used: 5269761558 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.8 bits) S2: 157 (65.6 bits)