BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3017 (PAB3017) DE:Hypothetical protein (85 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75190 hypothetical protein PAB3017 - Pyrococcus abyssi (st... 179 5e-45 gi|11499409 A. fulgidus predicted coding region AF1821 [Archaeog... 85 2e-16 >pir||A75190 hypothetical protein PAB3017 - Pyrococcus abyssi (strain Orsay) >gi|5457477|emb|CAB48968.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 85 Score = 179 bits (450), Expect = 5e-45 Identities = 84/85 (98%), Positives = 85/85 (99%) Query: 1 VSDIETRKCPICGGTMVKSKAKNAGYARFFWKPPWKSKATGILRPVVEATPYLCLNCGVV 60 +SDIETRKCPICGGTMVKSKAKNAGYARFFWKPPWKSKATGILRPVVEATPYLCLNCGVV Sbjct: 1 MSDIETRKCPICGGTMVKSKAKNAGYARFFWKPPWKSKATGILRPVVEATPYLCLNCGVV 60 Query: 61 LAFVDDETLSTLREEFEEKKLEVGL 85 LAFVDDETLSTLREEFEEKKLEVGL Sbjct: 61 LAFVDDETLSTLREEFEEKKLEVGL 85 >gi|11499409 A. fulgidus predicted coding region AF1821 [Archaeoglobus fulgidus] >gi|7483714|pir||D69477 hypothetical protein AF1821 - Archaeoglobus fulgidus >gi|2648731|gb|AAB89435.1| (AE000977) A. fulgidus predicted coding region AF1821 [Archaeoglobus fulgidus] Length = 81 Score = 85.0 bits (207), Expect = 2e-16 Identities = 34/71 (47%), Positives = 51/71 (70%), Gaps = 1/71 (1%) Query: 7 RKCPICGGTMVKSKAKNAGYARFFWKPPWKSKATGILRPVVEATPYLCLNCGVVLAFVDD 66 RKCP+CGG MV+S+ AGY+R+FW+ PW+ K L ++A P+LC+ CG V+ +V++ Sbjct: 3 RKCPLCGGEMVRSRTNQAGYSRYFWRAPWE-KGLAKLGRGIDAYPWLCIKCGAVIPYVEE 61 Query: 67 ETLSTLREEFE 77 TL LR+E+E Sbjct: 62 STLEKLRKEYE 72 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.137 0.430 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32086877 Number of Sequences: 2977 Number of extensions: 1073805 Number of successful extensions: 3332 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3330 Number of HSP's gapped (non-prelim): 2 length of query: 85 length of database: 189,106,746 effective HSP length: 47 effective length of query: 38 effective length of database: 160,977,857 effective search space: 6117158566 effective search space used: 6117158566 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 158 (66.0 bits)