BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PAB3055 (PAB3055) DE:Hypothetical protein
         (70 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||H75208 hypothetical protein PAB3055 - Pyrococcus abyssi (st...   138  1e-32

>pir||H75208 hypothetical protein PAB3055 - Pyrococcus abyssi (strain Orsay)
          >gi|5457628|emb|CAB49119.1| (AJ248283) hypothetical
          protein [Pyrococcus abyssi]
          Length = 70
          
 Score =  138 bits (343), Expect = 1e-32
 Identities = 70/70 (100%), Positives = 70/70 (100%)

Query: 1  MVMELSKLYGKLIYNTKGKYVGKVDEVVIDIKEREGRVLILALPGERVGVPYEKVVAVGD 60
          MVMELSKLYGKLIYNTKGKYVGKVDEVVIDIKEREGRVLILALPGERVGVPYEKVVAVGD
Sbjct: 1  MVMELSKLYGKLIYNTKGKYVGKVDEVVIDIKEREGRVLILALPGERVGVPYEKVVAVGD 60

Query: 61 IILVQASEKK 70
          IILVQASEKK
Sbjct: 61 IILVQASEKK 70


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.317    0.142    0.378 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23191557
Number of Sequences: 2977
Number of extensions: 753116
Number of successful extensions: 2035
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2034
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 189,106,746
effective HSP length: 49
effective length of query: 21
effective length of database: 159,780,883
effective search space: 3355398543
effective search space used: 3355398543
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.6 bits)
S2: 156 (65.2 bits)