BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3072 (PAB3072) DE:Hypothetical protein (49 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75218 hypothetical protein PAB3072 - Pyrococcus abyssi (st... 106 3e-23 pir||A71204 probable DNA-directed RNA polymerase - Pyrococcus ho... 101 1e-21 >pir||F75218 hypothetical protein PAB3072 - Pyrococcus abyssi (strain Orsay) >gi|5457706|emb|CAB49197.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 49 Score = 106 bits (262), Expect = 3e-23 Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAI 49 MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAI Sbjct: 1 MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAI 49 >pir||A71204 probable DNA-directed RNA polymerase - Pyrococcus horikoshii >gi|3258341|dbj|BAA31024.1| (AP000007) 77aa long hypothetical DNA-directed RNA polymerase [Pyrococcus horikoshii] Length = 77 Score = 101 bits (248), Expect = 1e-21 Identities = 44/49 (89%), Positives = 47/49 (95%) Query: 1 MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAI 49 M EA+YRCAKCGREVK+DLS TRDLRCPYCGSKILYKPRPK+PRRVKAI Sbjct: 29 MPEAVYRCAKCGREVKLDLSTTRDLRCPYCGSKILYKPRPKIPRRVKAI 77 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.329 0.144 0.460 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17778602 Number of Sequences: 2977 Number of extensions: 476931 Number of successful extensions: 2540 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2538 Number of HSP's gapped (non-prelim): 2 length of query: 49 length of database: 189,106,746 effective HSP length: 28 effective length of query: 21 effective length of database: 172,349,110 effective search space: 3619331310 effective search space used: 3619331310 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 156 (65.2 bits)