BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3079 (PAB3079) DE:Hypothetical protein (105 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75221 hypothetical protein PAB3079 - Pyrococcus abyssi (st... 212 1e-54 >pir||A75221 hypothetical protein PAB3079 - Pyrococcus abyssi (strain Orsay) >gi|5457725|emb|CAB49216.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 105 Score = 212 bits (533), Expect = 1e-54 Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MLEDLLEHAKDILGYQRPVKVRIRPLKMSIARVSFKYGTITLDPAVLNLEEEEMFYILIH 60 MLEDLLEHAKDILGYQRPVKVRIRPLKMSIARVSFKYGTITLDPAVLNLEEEEMFYILIH Sbjct: 1 MLEDLLEHAKDILGYQRPVKVRIRPLKMSIARVSFKYGTITLDPAVLNLEEEEMFYILIH 60 Query: 61 ELAHLKAETSYHSSSFWREVEKVFPGERAKEIEDRIMTKLQRNMV 105 ELAHLKAETSYHSSSFWREVEKVFPGERAKEIEDRIMTKLQRNMV Sbjct: 61 ELAHLKAETSYHSSSFWREVEKVFPGERAKEIEDRIMTKLQRNMV 105 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35933203 Number of Sequences: 2977 Number of extensions: 1207395 Number of successful extensions: 3017 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3016 Number of HSP's gapped (non-prelim): 1 length of query: 105 length of database: 189,106,746 effective HSP length: 54 effective length of query: 51 effective length of database: 156,788,448 effective search space: 7996210848 effective search space used: 7996210848 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)