BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3084 (PAB3084) DE:Hypothetical protein (94 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75143 hypothetical protein PAB3084 - Pyrococcus abyssi (st... 195 1e-49 sp|O26972|Y886_METTH HYPOTHETICAL PROTEIN MTH886 >gi|7482271|pir... 70 5e-12 >pir||G75143 hypothetical protein PAB3084 - Pyrococcus abyssi (strain Orsay) >gi|5457740|emb|CAB49230.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 94 Score = 195 bits (490), Expect = 1e-49 Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MKRLGKVSHYAKQGLLIVRSTWVPSLNDPVIDKDLKFVGIVKDVFGPVKRPYVAIKPKVD 60 MKRLGKVSHYAKQGLLIVRSTWVPSLNDPVIDKDLKFVGIVKDVFGPVKRPYVAIKPKVD Sbjct: 1 MKRLGKVSHYAKQGLLIVRSTWVPSLNDPVIDKDLKFVGIVKDVFGPVKRPYVAIKPKVD 60 Query: 61 DPEKYVGQVLYIDERRKKRKERKGRGRMKKKFKG 94 DPEKYVGQVLYIDERRKKRKERKGRGRMKKKFKG Sbjct: 61 DPEKYVGQVLYIDERRKKRKERKGRGRMKKKFKG 94 >sp|O26972|Y886_METTH HYPOTHETICAL PROTEIN MTH886 >gi|7482271|pir||D69218 conserved hypothetical protein MTH886 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2621980|gb|AAB85384.1| (AE000864) conserved protein [Methanobacterium thermoautotrophicum] Length = 92 Score = 70.2 bits (169), Expect = 5e-12 Identities = 37/91 (40%), Positives = 54/91 (58%), Gaps = 4/91 (4%) Query: 1 MKRLGKVSHYAKQGLLIVRSTWVPSLNDPVIDKDLKFVGIVKDVFGPVKRPYVAIKP-KV 59 MK LG +SH + +G +I RS L PV D K +G V D+FGP + PY++IKP + Sbjct: 1 MKALGNISHVSNKGRIIARSDRTQQLGAPVFTSDGKRIGKVHDIFGPTRNPYISIKPSRA 60 Query: 60 DDPEKY---VGQVLYIDERRKKRKERKGRGR 87 +PEK+ VG+ LY+ + K+ R+ R R Sbjct: 61 INPEKFENRVGETLYVGIKNVKKWGRRKRRR 91 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.143 0.420 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37131209 Number of Sequences: 2977 Number of extensions: 1495943 Number of successful extensions: 4468 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4467 Number of HSP's gapped (non-prelim): 2 length of query: 94 length of database: 189,106,746 effective HSP length: 49 effective length of query: 45 effective length of database: 159,780,883 effective search space: 7190139735 effective search space used: 7190139735 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)