BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3086 (PAB3086) DE:Hypothetical protein (88 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75144 hypothetical protein PAB3086 - Pyrococcus abyssi (st... 181 2e-45 pir||E71008 hypothetical protein PH1363 - Pyrococcus horikoshii ... 68 3e-11 pir||G83370 hydrogen cyanide synthase HcnB PA2194 [imported] - P... 68 3e-11 pir||H75122 sarcosine oxidase alpha chain truncated homolog PAB1... 66 9e-11 >pir||E75144 hypothetical protein PAB3086 - Pyrococcus abyssi (strain Orsay) >gi|5457746|emb|CAB49236.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 88 Score = 181 bits (454), Expect = 2e-45 Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MRIVCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKR 60 MRIVCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKR Sbjct: 1 MRIVCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKR 60 Query: 61 MEDIPLPNARFPIRPVKVEALLGGEGEE 88 MEDIPLPNARFPIRPVKVEALLGGEGEE Sbjct: 61 MEDIPLPNARFPIRPVKVEALLGGEGEE 88 >pir||E71008 hypothetical protein PH1363 - Pyrococcus horikoshii >gi|3257786|dbj|BAA30469.1| (AP000006) 493aa long hypothetical protein [Pyrococcus horikoshii] Length = 493 Score = 67.5 bits (162), Expect = 3e-11 Identities = 31/78 (39%), Positives = 55/78 (69%), Gaps = 1/78 (1%) Query: 4 VCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKRMED 63 +C C DV+++ ++ +I +G+TDL+ ++RL + MG CQGR C+ +++++TGK++ + Sbjct: 414 ICGC-DVSLKKVDEVIRKGITDLQIIKRLTHLAMGFCQGRYCLFNGAVVVSQRTGKKLSE 472 Query: 64 IPLPNARFPIRPVKVEAL 81 I LP AR PI+ VK+ L Sbjct: 473 IDLPVARSPIKNVKMGIL 490 >pir||G83370 hydrogen cyanide synthase HcnB PA2194 [imported] - Pseudomonas aeruginosa (strain PAO1) >gi|9948216|gb|AAG05582.1|AE004646_3 (AE004646) hydrogen cyanide synthase HcnB [Pseudomonas aeruginosa] Length = 464 Score = 67.5 bits (162), Expect = 3e-11 Identities = 34/78 (43%), Positives = 44/78 (55%), Gaps = 2/78 (2%) Query: 3 IVCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKRME 62 ++CRC VT DIER +++GV D+ L+ R GMG CQGR CI L R TG+ Sbjct: 381 VICRCEQVTRGDIERALEQGVQDIAGLKMRTRAGMGDCQGRMCIGYCSDRLRRATGR--H 438 Query: 63 DIPLPNARFPIRPVKVEA 80 D+ RFPI P+ A Sbjct: 439 DVGWLRPRFPIDPIPFSA 456 >pir||H75122 sarcosine oxidase alpha chain truncated homolog PAB1842 [similarity] - Pyrococcus abyssi (strain Orsay) >gi|5458208|emb|CAB49697.1| (AJ248285) sarcosine oxidase, subunit alpha related (soxA), Nter fragment [Pyrococcus abyssi] Length = 496 Score = 66.0 bits (158), Expect = 9e-11 Identities = 31/78 (39%), Positives = 54/78 (68%), Gaps = 1/78 (1%) Query: 4 VCRCNDVTVEDIERLIDEGVTDLEELRRLLRIGMGPCQGRTCIPILISILARKTGKRMED 63 +C C DV+++ ++ +I G+TDL+ ++RL + MG CQGR C+ I++++TG+R+ + Sbjct: 417 ICGC-DVSLKKVDDVIRRGITDLQIIKRLTHLAMGFCQGRYCLFNGALIVSQRTGRRLSE 475 Query: 64 IPLPNARFPIRPVKVEAL 81 I LP AR PI+ V++ L Sbjct: 476 IDLPVARSPIKNVRMGVL 493 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.147 0.437 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32763917 Number of Sequences: 2977 Number of extensions: 1167844 Number of successful extensions: 2713 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 2712 Number of HSP's gapped (non-prelim): 4 length of query: 88 length of database: 189,106,746 effective HSP length: 47 effective length of query: 41 effective length of database: 160,977,857 effective search space: 6600092137 effective search space used: 6600092137 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 158 (66.0 bits)