BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3103 (PAB3103) DE:Hypothetical protein (79 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75155 hypothetical protein PAB3103 - Pyrococcus abyssi (st... 157 1e-38 gi|11499579 conserved hypothetical protein [Archaeoglobus fulgid... 95 1e-19 sp|Q58522|YB22_METJA HYPOTHETICAL PROTEIN MJ1122 >gi|2128679|pir... 88 1e-17 pir||C71100 hypothetical protein PHS031 - Pyrococcus horikoshii ... 73 4e-13 >pir||G75155 hypothetical protein PAB3103 - Pyrococcus abyssi (strain Orsay) >gi|5457836|emb|CAB49326.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 79 Score = 157 bits (393), Expect = 1e-38 Identities = 78/79 (98%), Positives = 79/79 (99%) Query: 1 VISLSKTITIADDVYYELVKMKGNKSFSELLRELIGKKKKGNLDILMIAFGTMSEEEVKE 60 +ISLSKTITIADDVYYELVKMKGNKSFSELLRELIGKKKKGNLDILMIAFGTMSEEEVKE Sbjct: 1 MISLSKTITIADDVYYELVKMKGNKSFSELLRELIGKKKKGNLDILMIAFGTMSEEEVKE 60 Query: 61 FKKKIKEVEEWINSWTPVS 79 FKKKIKEVEEWINSWTPVS Sbjct: 61 FKKKIKEVEEWINSWTPVS 79 >gi|11499579 conserved hypothetical protein [Archaeoglobus fulgidus] >gi|3123136|sp|O28282|YJ97_ARCFU HYPOTHETICAL PROTEIN AF1997 >gi|7450172|pir||D69499 conserved hypothetical protein AF1997 - Archaeoglobus fulgidus >gi|2648547|gb|AAB89264.1| (AE000965) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 73 Score = 94.8 bits (232), Expect = 1e-19 Identities = 44/71 (61%), Positives = 62/71 (86%), Gaps = 2/71 (2%) Query: 4 LSKTITIADDVYYELVKMKGNKSFSELLRELIGKKKKGNLDILMIAFGTMSEEEVKEFKK 63 ++KTI+I+DDVY LVK+KG +SFSE++REL+ KK+GN D+LM+AFGT SEEEV++ K+ Sbjct: 1 MTKTISISDDVYEMLVKIKGKRSFSEVIRELV--KKEGNFDLLMVAFGTRSEEEVEKLKR 58 Query: 64 KIKEVEEWINS 74 ++KEVEEW+ S Sbjct: 59 EMKEVEEWMQS 69 >sp|Q58522|YB22_METJA HYPOTHETICAL PROTEIN MJ1122 >gi|2128679|pir||A64440 hypothetical protein MJ1122 - Methanococcus jannaschii >gi|1591761|gb|AAB99124.1| (U67555) conserved hypothetical protein [Methanococcus jannaschii] Length = 77 Score = 87.8 bits (214), Expect = 1e-17 Identities = 39/68 (57%), Positives = 56/68 (82%) Query: 7 TITIADDVYYELVKMKGNKSFSELLRELIGKKKKGNLDILMIAFGTMSEEEVKEFKKKIK 66 TITI DDVY EL+K+KG KS SE ++EL+ ++K+ NLD+ MIAFG+ SEE+V++ KK++K Sbjct: 6 TITIDDDVYKELLKLKGRKSVSEFIKELLEERKRKNLDVFMIAFGSRSEEDVEKLKKELK 65 Query: 67 EVEEWINS 74 E E+W+ S Sbjct: 66 EAEKWMQS 73 >pir||C71100 hypothetical protein PHS031 - Pyrococcus horikoshii >gi|3257478|dbj|BAA30161.1| (AP000004) 52aa long hypothetical protein [Pyrococcus horikoshii] Length = 52 Score = 73.0 bits (176), Expect = 4e-13 Identities = 35/41 (85%), Positives = 39/41 (94%) Query: 1 VISLSKTITIADDVYYELVKMKGNKSFSELLRELIGKKKKG 41 V S+SKTITIADDVYYELVKMKG +SFSE+LRELIGKKK+G Sbjct: 8 VTSMSKTITIADDVYYELVKMKGKRSFSEVLRELIGKKKEG 48 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.313 0.132 0.360 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29228781 Number of Sequences: 2977 Number of extensions: 1008923 Number of successful extensions: 5135 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5131 Number of HSP's gapped (non-prelim): 4 length of query: 79 length of database: 189,106,746 effective HSP length: 58 effective length of query: 21 effective length of database: 154,394,500 effective search space: 3242284500 effective search space used: 3242284500 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 42 (21.9 bits) S2: 156 (65.2 bits)