BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PAB3148 (PAB3148) DE:Hypothetical protein
         (58 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||F75180 hypothetical protein PAB3148 - Pyrococcus abyssi (st...   131  7e-31

>pir||F75180 hypothetical protein PAB3148 - Pyrococcus abyssi (strain Orsay)
          >gi|5458035|emb|CAB49525.1| (AJ248284) hypothetical
          protein [Pyrococcus abyssi]
          Length = 58
          
 Score =  131 bits (327), Expect = 7e-31
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MERKKLVCPLCGGTKFRVEEGKIDSKWGFTAHKVKIVICENCGYVMLFYEGRTIWDFD 58
          MERKKLVCPLCGGTKFRVEEGKIDSKWGFTAHKVKIVICENCGYVMLFYEGRTIWDFD
Sbjct: 1  MERKKLVCPLCGGTKFRVEEGKIDSKWGFTAHKVKIVICENCGYVMLFYEGRTIWDFD 58


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.327    0.146    0.501 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24455861
Number of Sequences: 2977
Number of extensions: 759882
Number of successful extensions: 1855
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1854
Number of HSP's gapped (non-prelim): 1
length of query: 58
length of database: 189,106,746
effective HSP length: 37
effective length of query: 21
effective length of database: 166,962,727
effective search space: 3506217267
effective search space used: 3506217267
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 40 (21.7 bits)
S2: 156 (65.2 bits)