BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3293 (PAB3293) DE:Hypothetical protein (72 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75099 hypothetical protein PAB3293 - Pyrococcus abyssi (st... 142 5e-34 >pir||A75099 hypothetical protein PAB3293 - Pyrococcus abyssi (strain Orsay) >gi|5458606|emb|CAB50094.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 72 Score = 142 bits (354), Expect = 5e-34 Identities = 71/72 (98%), Positives = 72/72 (99%) Query: 1 LRKLGLNDRQIKAVLYVREKGRISNKEYQGLFGVSKPTASRELDSLVRKGILERVGVTRR 60 +RKLGLNDRQIKAVLYVREKGRISNKEYQGLFGVSKPTASRELDSLVRKGILERVGVTRR Sbjct: 1 MRKLGLNDRQIKAVLYVREKGRISNKEYQGLFGVSKPTASRELDSLVRKGILERVGVTRR 60 Query: 61 GTYYVLKGSNVS 72 GTYYVLKGSNVS Sbjct: 61 GTYYVLKGSNVS 72 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.138 0.372 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23163453 Number of Sequences: 2977 Number of extensions: 705638 Number of successful extensions: 1870 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1869 Number of HSP's gapped (non-prelim): 1 length of query: 72 length of database: 189,106,746 effective HSP length: 51 effective length of query: 21 effective length of database: 158,583,909 effective search space: 3330262089 effective search space used: 3330262089 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 156 (65.2 bits)