BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3299 (PAB3299) DE:Hypothetical protein (89 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75101 hypothetical protein PAB3299 - Pyrococcus abyssi (st... 177 3e-44 >pir||E75101 hypothetical protein PAB3299 - Pyrococcus abyssi (strain Orsay) >gi|5458626|emb|CAB50114.1| (AJ248286) hypothetical protein [Pyrococcus abyssi] Length = 89 Score = 177 bits (444), Expect = 3e-44 Identities = 89/89 (100%), Positives = 89/89 (100%) Query: 1 MAQEGFLVAGIWILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYY 60 MAQEGFLVAGIWILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYY Sbjct: 1 MAQEGFLVAGIWILLGTALMAMYRVIAGPTLPDRVVGLNTITTKIVGILTILAILWREYY 60 Query: 61 LIDMAIVLLMVNSIGGLILAKHMERRGND 89 LIDMAIVLLMVNSIGGLILAKHMERRGND Sbjct: 61 LIDMAIVLLMVNSIGGLILAKHMERRGND 89 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29992714 Number of Sequences: 2977 Number of extensions: 919453 Number of successful extensions: 3164 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3163 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 189,106,746 effective HSP length: 48 effective length of query: 41 effective length of database: 160,379,370 effective search space: 6575554170 effective search space used: 6575554170 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 158 (66.0 bits)