BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3329 (PAB3329) DE:Hypothetical protein (97 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75040 hypothetical protein PAB3329 - Pyrococcus abyssi (st... 198 1e-50 gb|AAK42336.1| Conserved hypothetical protein [Sulfolobus solfat... 71 3e-12 pir||S74067 hypothetical protein c0136 - Sulfolobus solfataricus... 71 3e-12 gb|AAG18946.1| (AE004996) Vng0389c [Halobacterium sp. NRC-1] 67 5e-11 >pir||A75040 hypothetical protein PAB3329 - Pyrococcus abyssi (strain Orsay) >gi|5458727|emb|CAB50214.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 97 Score = 198 bits (499), Expect = 1e-50 Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MPSRREKIIELLLERDYSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPA 60 MPSRREKIIELLLERDYSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPA Sbjct: 1 MPSRREKIIELLLERDYSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPA 60 Query: 61 QCRKCGFTFRPEINIPSRCPRCKSEWIEEPRFKLERK 97 QCRKCGFTFRPEINIPSRCPRCKSEWIEEPRFKLERK Sbjct: 61 QCRKCGFTFRPEINIPSRCPRCKSEWIEEPRFKLERK 97 >gb|AAK42336.1| Conserved hypothetical protein [Sulfolobus solfataricus] Length = 101 Score = 71.0 bits (171), Expect = 3e-12 Identities = 39/96 (40%), Positives = 60/96 (61%), Gaps = 6/96 (6%) Query: 5 REKIIELLLERD--YSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPAQC 62 REKI LL D S E+ R L+++ +K + + L+ +A+ +KR+G +L++ PA+C Sbjct: 9 REKIFLLLFYSDEPLSAREIMRRLDVR---KEKEVYDHLEHLARSSKRKGYMLIIIPAKC 65 Query: 63 RKCGFTFRPE-INIPSRCPRCKSEWIEEPRFKLERK 97 + CG+ F + I PSRCP CKSE IE P+F + K Sbjct: 66 KSCGYVFNSDKIKKPSRCPICKSEKIEMPKFLIRNK 101 >pir||S74067 hypothetical protein c0136 - Sulfolobus solfataricus >gi|1707766|emb|CAA69438.1| (Y08256) orf c01036 [Sulfolobus solfataricus] Length = 101 Score = 71.0 bits (171), Expect = 3e-12 Identities = 39/96 (40%), Positives = 60/96 (61%), Gaps = 6/96 (6%) Query: 5 REKIIELLLERD--YSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPAQC 62 REKI LL D S E+ R L+++ +K + + L+ +A+ +KR+G +L++ PA+C Sbjct: 9 REKIFLLLFYSDEPLSAREIMRRLDVR---KEKEVYDHLEHLARSSKRKGYMLIIIPAKC 65 Query: 63 RKCGFTFRPE-INIPSRCPRCKSEWIEEPRFKLERK 97 + CG+ F + I PSRCP CKSE IE P+F + K Sbjct: 66 KSCGYVFNSDKIKKPSRCPICKSEKIEMPKFLIRNK 101 >gb|AAG18946.1| (AE004996) Vng0389c [Halobacterium sp. NRC-1] Length = 96 Score = 67.1 bits (161), Expect = 5e-11 Identities = 38/92 (41%), Positives = 52/92 (56%), Gaps = 5/92 (5%) Query: 5 REKIIELLLERDYSPSELARILEIKGKGAKKVILEDLKVIAKIAKREGMVLLVKPAQCRK 64 RE++ L E+ +PSE+A E+ A+ L ++ IA+ LLV+P CR Sbjct: 7 RERVRAALREQPATPSEVAAAFEV----ARGTALTHVRHIAESLDSADEELLVRPPACRD 62 Query: 65 CGFT-FRPEINIPSRCPRCKSEWIEEPRFKLE 95 CGF F +N+PSRCP CKSE I EP F +E Sbjct: 63 CGFEDFDDPVNVPSRCPECKSESIAEPAFVVE 94 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.141 0.415 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36176325 Number of Sequences: 2977 Number of extensions: 1270810 Number of successful extensions: 4815 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4810 Number of HSP's gapped (non-prelim): 4 length of query: 97 length of database: 189,106,746 effective HSP length: 50 effective length of query: 47 effective length of database: 159,182,396 effective search space: 7481572612 effective search space used: 7481572612 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)