BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3357 (moaD) DE:molybdopterin converting factor, subunit 1 (moaD) (89 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75053 molybdopterin converting factor, chain 1 (moad) PAB3... 182 1e-45 >pir||H75053 molybdopterin converting factor, chain 1 (moad) PAB3357 - Pyrococcus abyssi (strain Orsay) >gi|5458838|emb|CAB50325.1| (AJ248287) molybdopterin converting factor, subunit 1 (moaD) [Pyrococcus abyssi] Length = 89 Score = 182 bits (456), Expect = 1e-45 Identities = 88/89 (98%), Positives = 89/89 (99%) Query: 1 VKVRVRYFARFRDLAGTSEEEIELKDGATIRDLIEEIKRRHERFKSEVFGEDFDEDADVN 60 +KVRVRYFARFRDLAGTSEEEIELKDGATIRDLIEEIKRRHERFKSEVFGEDFDEDADVN Sbjct: 1 MKVRVRYFARFRDLAGTSEEEIELKDGATIRDLIEEIKRRHERFKSEVFGEDFDEDADVN 60 Query: 61 VSLNGRYVSWDEKLKDGDVVGIFPPVSGG 89 VSLNGRYVSWDEKLKDGDVVGIFPPVSGG Sbjct: 61 VSLNGRYVSWDEKLKDGDVVGIFPPVSGG 89 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.142 0.405 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36136299 Number of Sequences: 2977 Number of extensions: 1431158 Number of successful extensions: 4614 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4613 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 189,106,746 effective HSP length: 50 effective length of query: 39 effective length of database: 159,182,396 effective search space: 6208113444 effective search space used: 6208113444 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 158 (66.0 bits)