BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB3384 (rpl39E) DE:LSU ribosomal protein L39E (rpl39E) (51 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C75066 lsu ribosomal protein l39e (rpl39e) PAB3384 - Pyroco... 108 8e-24 sp|O27650|RL39_METTH 50S RIBOSOMAL PROTEIN L39E >gi|7440766|pir|... 83 3e-16 sp|P54056|RL39_METJA 50S RIBOSOMAL PROTEIN L39E >gi|2119127|pir|... 76 3e-14 gb|AAK40683.1| LSU ribosomal protein L39E (rpl39E) [Sulfolobus s... 69 8e-12 gi|11499649 LSU ribosomal protein L39E (rpl39E) [Archaeoglobus f... 68 2e-11 emb|CAC11201.1| (AL445063) probable 50S ribosomal protein L39 [T... 66 7e-11 >pir||C75066 lsu ribosomal protein l39e (rpl39e) PAB3384 - Pyrococcus abyssi (strain Orsay) >gi|5458937|emb|CAB50424.1| (AJ248287) LSU ribosomal protein L39E (rpl39E) [Pyrococcus abyssi] Length = 51 Score = 108 bits (267), Expect = 8e-24 Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLKE 51 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLKE Sbjct: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLKE 51 >sp|O27650|RL39_METTH 50S RIBOSOMAL PROTEIN L39E >gi|7440766|pir||E69082 ribosomal protein L39 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2622738|gb|AAB86086.1| (AE000920) ribosomal protein L39 [Methanobacterium thermoautotrophicum] Length = 51 Score = 83.1 bits (202), Expect = 3e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Query: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK 50 M+RNK +A+KLR+AKA +QNRRVP WV+VKTN RV +HPK RHWRRTKLK Sbjct: 1 MSRNKHVARKLRMAKANRQNRRVPAWVMVKTNYRVRSHPKMRHWRRTKLK 50 >sp|P54056|RL39_METJA 50S RIBOSOMAL PROTEIN L39E >gi|2119127|pir||A64386 ribosomal protein L46 - Methanococcus jannaschii >gi|1591404|gb|AAB98684.1| (U67516) LSU ribosomal protein L39E [Methanococcus jannaschii] Length = 52 Score = 76.5 bits (185), Expect = 3e-14 Identities = 36/50 (72%), Positives = 41/50 (82%) Query: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK 50 M NKPL KK+RLAKA+KQNRRVP++VIVKT RV HPK R+WRR KLK Sbjct: 2 MGSNKPLGKKVRLAKALKQNRRVPLFVIVKTRGRVRFHPKMRYWRRKKLK 51 >gb|AAK40683.1| LSU ribosomal protein L39E (rpl39E) [Sulfolobus solfataricus] Length = 53 Score = 68.7 bits (165), Expect = 8e-12 Identities = 29/50 (58%), Positives = 39/50 (78%) Query: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK 50 M+RNKP+AKK RLAKA+K N +P+W+++KT RV +P RR+WRR LK Sbjct: 3 MSRNKPVAKKFRLAKALKANSPIPIWIVLKTRGRVRYNPLRRNWRRNDLK 52 >gi|11499649 LSU ribosomal protein L39E (rpl39E) [Archaeoglobus fulgidus] >gi|3122732|sp|O28212|RL39_ARCFU 50S RIBOSOMAL PROTEIN L39E >gi|7440767|pir||B69508 LSU ribosomal protein L39E (rpl39E) homolog - Archaeoglobus fulgidus >gi|2648484|gb|AAB89208.1| (AE000961) LSU ribosomal protein L39E (rpl39E) [Archaeoglobus fulgidus] Length = 50 Score = 67.5 bits (162), Expect = 2e-11 Identities = 31/46 (67%), Positives = 34/46 (73%) Query: 5 KPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK 50 K + K RLAKA KQNRR PVW+ VKT R V PKRRHWRR+KLK Sbjct: 4 KTVGVKKRLAKAYKQNRRAPVWITVKTKRSVFGSPKRRHWRRSKLK 49 >emb|CAC11201.1| (AL445063) probable 50S ribosomal protein L39 [Thermoplasma acidophilum] Length = 51 Score = 65.6 bits (157), Expect = 7e-11 Identities = 29/50 (58%), Positives = 39/50 (78%) Query: 1 MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK 50 M+RNK L +K+RL K +KQNRRVP WV+++T R+V +P RR+WRR LK Sbjct: 1 MSRNKELGRKIRLMKKIKQNRRVPGWVMMRTARKVTQNPLRRNWRRGSLK 50 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.132 0.411 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16889480 Number of Sequences: 2977 Number of extensions: 398914 Number of successful extensions: 1026 Number of sequences better than 1.0e-10: 6 Number of HSP's better than 0.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1020 Number of HSP's gapped (non-prelim): 6 length of query: 51 length of database: 189,106,746 effective HSP length: 30 effective length of query: 21 effective length of database: 171,152,136 effective search space: 3594194856 effective search space used: 3594194856 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)