BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7080 (rps14P) DE:SSU ribosomal protein S14P (rps14P) (56 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O74093|RS14_PYRHO 30S RIBOSOMAL PROTEIN S14P >gi|7440408|pir|... 126 3e-29 sp|O26125|RS14_METTH 30S RIBOSOMAL PROTEIN S14P >gi|7440410|pir|... 74 2e-13 sp|P14041|RS14_METVA 30S RIBOSOMAL PROTEIN S14P >gi|70979|pir||R... 66 5e-11 >sp|O74093|RS14_PYRHO 30S RIBOSOMAL PROTEIN S14P >gi|7440408|pir||H71185 probable ribosomal protein S14 - Pyrococcus horikoshii >gi|7521697|pir||B75146 ssu ribosomal protein s14p (rps14p) PAB7080 - Pyrococcus abyssi (strain Orsay) >gi|3258196|dbj|BAA30879.1| (AP000007) 56aa long hypothetical 30S ribosomal protein S14 [Pyrococcus horikoshii] >gi|5457759|emb|CAB49249.1| (AJ248284) SSU ribosomal protein S14P (rps14P) [Pyrococcus abyssi] Length = 56 Score = 126 bits (313), Expect = 3e-29 Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE 56 MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE Sbjct: 1 MAKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKYE 56 >sp|O26125|RS14_METTH 30S RIBOSOMAL PROTEIN S14P >gi|7440410|pir||C69094 ribosomal protein S14 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2621045|gb|AAB84518.1| (AE000795) ribosomal protein S29 (E.coli S14) [Methanobacterium thermoautotrophicum] Length = 50 Score = 74.1 bits (179), Expect = 2e-13 Identities = 28/45 (62%), Positives = 38/45 (84%) Query: 11 PRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLGFRKY 55 PRK+GK +R+C RCG + ++R +GLMLCR CFRE+APK+GF+KY Sbjct: 5 PRKYGKASRKCSRCGDHSALVRRYGLMLCRQCFRELAPKIGFKKY 49 >sp|P14041|RS14_METVA 30S RIBOSOMAL PROTEIN S14P >gi|70979|pir||R3MX14 ribosomal protein S14 - Methanococcus vannielii >gi|44762|emb|CAA34694.1| (X16720) rpS14 (AA 1-53) [Methanococcus vannielii] Length = 53 Score = 66.0 bits (158), Expect = 5e-11 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Query: 13 KFGKGARRCIRCGQYGP-IIRIHGLMLCRHCFREVAPKLGFRKYE 56 K+G+G++ C RCG+ GP IIR +GL LCR CFRE+APKLGF+KY+ Sbjct: 9 KYGQGSKVCKRCGRKGPGIIRKYGLDLCRQCFRELAPKLGFKKYD 53 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.333 0.149 0.504 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22270647 Number of Sequences: 2977 Number of extensions: 662856 Number of successful extensions: 1573 Number of sequences better than 1.0e-10: 3 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1570 Number of HSP's gapped (non-prelim): 3 length of query: 56 length of database: 189,106,746 effective HSP length: 35 effective length of query: 21 effective length of database: 168,159,701 effective search space: 3531353721 effective search space used: 3531353721 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (22.0 bits) S2: 156 (65.2 bits)