BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7115 (PAB7115) DE:transcriptional regulatory protein, AsnC family (76 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C75165 transcription regulatory protein, asnc family PAB711... 152 4e-37 pir||G71176 probable transcription regulator - Pyrococcus horiko... 132 7e-31 pir||E71108 probable regulatory protein AsnC - Pyrococcus horiko... 75 1e-13 pir||H75051 hypothetical protein PAB7359 - Pyrococcus abyssi (st... 75 2e-13 >pir||C75165 transcription regulatory protein, asnc family PAB7115 - Pyrococcus abyssi (strain Orsay) >gi|5457912|emb|CAB49402.1| (AJ248284) transcriptional regulatory protein, AsnC family [Pyrococcus abyssi] Length = 76 Score = 152 bits (381), Expect = 4e-37 Identities = 76/76 (100%), Positives = 76/76 (100%) Query: 1 MDVFILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLR 60 MDVFILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLR Sbjct: 1 MDVFILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLR 60 Query: 61 KLPGIELSETLIASSY 76 KLPGIELSETLIASSY Sbjct: 61 KLPGIELSETLIASSY 76 >pir||G71176 probable transcription regulator - Pyrococcus horikoshii >gi|3258123|dbj|BAA30806.1| (AP000007) 74aa long hypothetical transcriptional regulator [Pyrococcus horikoshii] Length = 74 Score = 132 bits (328), Expect = 7e-31 Identities = 61/74 (82%), Positives = 73/74 (98%) Query: 3 VFILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLRKL 62 +FILLV+RPGLENEVYEKLK+RPEVKEIY++YGDYDI++RLS++GIKALD+FHD+VLRKL Sbjct: 1 MFILLVVRPGLENEVYEKLKDRPEVKEIYRLYGDYDIIIRLSVEGIKALDEFHDKVLRKL 60 Query: 63 PGIELSETLIASSY 76 GIE+SETLIASSY Sbjct: 61 RGIEISETLIASSY 74 >pir||E71108 probable regulatory protein AsnC - Pyrococcus horikoshii >gi|3257044|dbj|BAA29727.1| (AP000003) 75aa long hypothetical regulatory protein AsnC [Pyrococcus horikoshii] Length = 75 Score = 74.9 bits (181), Expect = 1e-13 Identities = 35/70 (50%), Positives = 50/70 (71%) Query: 4 FILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLRKLP 63 FIL+V G E EV EKL PEVKE Y VYG+YD+++++ D +K LD+F E +RK+P Sbjct: 5 FILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITEKIRKMP 64 Query: 64 GIELSETLIA 73 I+++ T+IA Sbjct: 65 EIQMTSTMIA 74 >pir||H75051 hypothetical protein PAB7359 - Pyrococcus abyssi (strain Orsay) >gi|5458822|emb|CAB50309.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 75 Score = 74.5 bits (180), Expect = 2e-13 Identities = 35/70 (50%), Positives = 50/70 (71%) Query: 4 FILLVIRPGLENEVYEKLKNRPEVKEIYKVYGDYDIVLRLSIDGIKALDKFHDEVLRKLP 63 FIL+V G E EV EKL PEVKE Y VYG+YD+++++ D +K LD+F E +RK+P Sbjct: 5 FILMVTAAGKEREVMEKLLAMPEVKEAYVVYGEYDLIVKVETDTLKDLDQFITERIRKMP 64 Query: 64 GIELSETLIA 73 I+++ T+IA Sbjct: 65 EIQMTSTMIA 74 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.145 0.399 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26542183 Number of Sequences: 2977 Number of extensions: 928235 Number of successful extensions: 2683 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2679 Number of HSP's gapped (non-prelim): 4 length of query: 76 length of database: 189,106,746 effective HSP length: 50 effective length of query: 26 effective length of database: 159,182,396 effective search space: 4138742296 effective search space used: 4138742296 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 156 (65.2 bits)