BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7211 (rpl40E) DE:LSU ribosomal protein L40E (rpl40E) (51 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O74010|RL40_PYRHO 50S RIBOSOMAL PROTEIN L40E >gi|7519916|pir|... 116 3e-26 sp|P54058|RL40_METJA 50S RIBOSOMAL PROTEIN L40E >gi|2129257|pir|... 75 8e-14 gi|11499025 LSU ribosomal protein L40E (rpl40E) [Archaeoglobus f... 73 3e-13 sp|O26653|RL40_METTH 50S RIBOSOMAL PROTEIN L40E >gi|7482816|pir|... 69 8e-12 >sp|O74010|RL40_PYRHO 50S RIBOSOMAL PROTEIN L40E >gi|7519916|pir||B75130 lsu ribosomal protein l40e (rpl40e) PAB7211 - Pyrococcus abyssi (strain Orsay) >gi|7521375|pir||C71001 probable ribosomal protein L40 - Pyrococcus horikoshii >gi|3257728|dbj|BAA30411.1| (AP000006) 51aa long hypothetical 50S ribosomal protein L40 [Pyrococcus horikoshii] >gi|5458266|emb|CAB49755.1| (AJ248285) LSU ribosomal protein L40E (rpl40E) [Pyrococcus abyssi] Length = 51 Score = 116 bits (288), Expect = 3e-26 Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRGGGR 51 MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRGGGR Sbjct: 1 MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRGGGR 51 >sp|P54058|RL40_METJA 50S RIBOSOMAL PROTEIN L40E >gi|2129257|pir||C64388 ribosomal protein L40 - Methanococcus jannaschii >gi|1591423|gb|AAB98701.1| (U67517) LSU ribosomal protein L40E (CEP52) [Methanococcus jannaschii] Length = 47 Score = 75.3 bits (182), Expect = 8e-14 Identities = 32/45 (71%), Positives = 35/45 (77%) Query: 4 FPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRG 48 F EA R+F K IC+RC A NPW A KCRKCGYK LRPKA+EPRG Sbjct: 3 FEEAMKRLFMKKICMRCNARNPWRATKCRKCGYKGLRPKAKEPRG 47 >gi|11499025 LSU ribosomal protein L40E (rpl40E) [Archaeoglobus fulgidus] >gi|3914753|sp|O28842|RL40_ARCFU 50S RIBOSOMAL PROTEIN L40E >gi|7483859|pir||E69428 LSU ribosomal protein L40E (rpl40E) homolog - Archaeoglobus fulgidus >gi|2649137|gb|AAB89814.1| (AE001004) LSU ribosomal protein L40E (rpl40E) [Archaeoglobus fulgidus] Length = 49 Score = 73.4 bits (177), Expect = 3e-13 Identities = 32/48 (66%), Positives = 37/48 (76%) Query: 1 MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRG 48 MARFPEAEAR+F IC+RC A NP A CRKCGYK LRPK++E +G Sbjct: 1 MARFPEAEARLFNVKICMRCNARNPMKARVCRKCGYKGLRPKSKERKG 48 >sp|O26653|RL40_METTH 50S RIBOSOMAL PROTEIN L40E >gi|7482816|pir||B69173 ribosomal protein L40 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2621629|gb|AAB85059.1| (AE000838) ribosomal protein L40 [Methanobacterium thermoautotrophicum] Length = 48 Score = 68.7 bits (165), Expect = 8e-12 Identities = 32/48 (66%), Positives = 36/48 (74%) Query: 1 MARFPEAEARIFKKYICLRCGATNPWGAEKCRKCGYKRLRPKAREPRG 48 MARF EAE R+F ICL+C A NP A+ CRKCGYK LR KA+EPRG Sbjct: 1 MARFEEAENRLFNIKICLKCNARNPPTAKTCRKCGYKGLRYKAKEPRG 48 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.143 0.494 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21105975 Number of Sequences: 2977 Number of extensions: 599296 Number of successful extensions: 2331 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2327 Number of HSP's gapped (non-prelim): 4 length of query: 51 length of database: 189,106,746 effective HSP length: 30 effective length of query: 21 effective length of database: 171,152,136 effective search space: 3594194856 effective search space used: 3594194856 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 156 (65.2 bits)