BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7338 (PAB7338) DE:Hypothetical protein (99 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75042 hypothetical protein PAB7338 - Pyrococcus abyssi (st... 203 3e-52 gi|11499137 conserved hypothetical protein [Archaeoglobus fulgid... 114 3e-25 dbj|BAB04294.1| (AP001509) unknown conserved protein in others [... 94 5e-19 pir||E70569 hypothetical protein Rv3488 - Mycobacterium tubercul... 83 1e-15 >pir||D75042 hypothetical protein PAB7338 - Pyrococcus abyssi (strain Orsay) >gi|5458746|emb|CAB50233.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 99 Score = 203 bits (512), Expect = 3e-52 Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MIRRVILGFMGLHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSR 60 MIRRVILGFMGLHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSR Sbjct: 1 MIRRVILGFMGLHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSR 60 Query: 61 WDVRNGRRVRLYEITGKGLEVLEEGKKKVKELCSEILEG 99 WDVRNGRRVRLYEITGKGLEVLEEGKKKVKELCSEILEG Sbjct: 61 WDVRNGRRVRLYEITGKGLEVLEEGKKKVKELCSEILEG 99 >gi|11499137 conserved hypothetical protein [Archaeoglobus fulgidus] >gi|7483137|pir||E69442 conserved hypothetical protein AF1542 - Archaeoglobus fulgidus >gi|2649019|gb|AAB89704.1| (AE000996) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 101 Score = 114 bits (282), Expect = 3e-25 Identities = 54/96 (56%), Positives = 76/96 (78%) Query: 3 RRVILGFMGLHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSRWD 62 R++ILGF +HILYHASKE I G++M++EL +HGY +SPGT+YP+L +ME GLLRSR Sbjct: 4 RKLILGFARVHILYHASKEEIYGSWMIEELGRHGYSISPGTLYPILHEMEREGLLRSRKV 63 Query: 63 VRNGRRVRLYEITGKGLEVLEEGKKKVKELCSEILE 98 V +GR ++Y IT KG ++L++ ++KVKEL EI+E Sbjct: 64 VVDGRVRKMYRITEKGWKLLDDAREKVKELFEEIME 99 >dbj|BAB04294.1| (AP001509) unknown conserved protein in others [Bacillus halodurans] Length = 102 Score = 93.6 bits (229), Expect = 5e-19 Identities = 44/98 (44%), Positives = 66/98 (66%) Query: 1 MIRRVILGFMGLHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSR 60 ++R++ LGF+ +HIL+HA + PI G +M++EL++HGYD+S GT+YP+L ME+ GLL + Sbjct: 5 ILRKLFLGFIQIHILHHAKEHPIFGLWMLEELKEHGYDMSAGTLYPILHSMEADGLLVKQ 64 Query: 61 WDVRNGRRVRLYEITGKGLEVLEEGKKKVKELCSEILE 98 G+ + Y T KG VL+E + K EL EI E Sbjct: 65 EQKVEGKIRKYYTTTAKGESVLKEARSKAYELFKEIKE 102 >pir||E70569 hypothetical protein Rv3488 - Mycobacterium tuberculosis (strain H37RV) >gi|2104411|emb|CAB08711.1| (Z95390) hypothetical protein Rv3488 [Mycobacterium tuberculosis] Length = 107 Score = 82.7 bits (201), Expect = 1e-15 Identities = 40/88 (45%), Positives = 58/88 (65%) Query: 12 LHILYHASKEPITGAYMMKELRKHGYDVSPGTMYPLLRKMESLGLLRSRWDVRNGRRVRL 71 LHIL+HA+ + GA++ +EL +HGY VSPGT+YP L ++E+ GLL S V +GR R+ Sbjct: 11 LHILHHAADNEVHGAWLTQELSRHGYRVSPGTLYPTLHRLEADGLLVSEQRVVDGRARRV 70 Query: 72 YEITGKGLEVLEEGKKKVKELCSEILEG 99 Y T G L E ++ ++EL E+L G Sbjct: 71 YRATPAGRAALTEDRRALEELAREVLGG 98 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.143 0.417 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38080533 Number of Sequences: 2977 Number of extensions: 1443301 Number of successful extensions: 3471 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3467 Number of HSP's gapped (non-prelim): 4 length of query: 99 length of database: 189,106,746 effective HSP length: 49 effective length of query: 50 effective length of database: 159,780,883 effective search space: 7989044150 effective search space used: 7989044150 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 159 (66.3 bits)