BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7387 (rpl31E) DE:LSU ribosomal protein L31E (rpl31E) (94 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75066 lsu ribosomal protein l31e (rpl31e) PAB7387 - Pyroco... 190 4e-48 sp|P54009|RL31_METJA 50S RIBOSOMAL PROTEIN L31E >gi|2129255|pir|... 82 1e-15 sp|O27649|RL31_METTH 50S RIBOSOMAL PROTEIN L31E >gi|7441071|pir|... 78 2e-14 gi|11499648 LSU ribosomal protein L31E (rpl31E) [Archaeoglobus f... 74 3e-13 sp|Q9YD25|RL31_AERPE 50S RIBOSOMAL PROTEIN L31E >gi|7521368|pir|... 73 7e-13 >pir||D75066 lsu ribosomal protein l31e (rpl31e) PAB7387 - Pyrococcus abyssi (strain Orsay) >gi|5458938|emb|CAB50425.1| (AJ248287) LSU ribosomal protein L31E (rpl31E) [Pyrococcus abyssi] Length = 94 Score = 190 bits (477), Expect = 4e-48 Identities = 94/94 (100%), Positives = 94/94 (100%) Query: 1 MPIKPGEEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWE 60 MPIKPGEEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWE Sbjct: 1 MPIKPGEEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWE 60 Query: 61 RGIEKPPSRLRVKVKVEEEDRDGKKVRIAYVDLA 94 RGIEKPPSRLRVKVKVEEEDRDGKKVRIAYVDLA Sbjct: 61 RGIEKPPSRLRVKVKVEEEDRDGKKVRIAYVDLA 94 >sp|P54009|RL31_METJA 50S RIBOSOMAL PROTEIN L31E >gi|2129255|pir||A64306 ribosomal protein L31 - Methanococcus jannaschii >gi|1590847|gb|AAB98030.1| (U67463) LSU ribosomal protein L31E [Methanococcus jannaschii] Length = 87 Score = 82.3 bits (200), Expect = 1e-15 Identities = 38/71 (53%), Positives = 53/71 (74%) Query: 7 EEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWERGIEKP 66 EE I+T+P+R + R KRAPRA+K +++F+ RH KA+ V I ++NEKIWERGI+KP Sbjct: 7 EERIYTIPLRDVINKSVRTKRAPRAIKKIKQFLKRHMKAEIVKIDNELNEKIWERGIQKP 66 Query: 67 PSRLRVKVKVE 77 P+R+RVK E Sbjct: 67 PARVRVKAVKE 77 >sp|O27649|RL31_METTH 50S RIBOSOMAL PROTEIN L31E >gi|7441071|pir||D69082 ribosomal protein L31 - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2622737|gb|AAB86085.1| (AE000920) ribosomal protein L31 [Methanobacterium thermoautotrophicum] Length = 81 Score = 78.4 bits (190), Expect = 2e-14 Identities = 39/73 (53%), Positives = 53/73 (72%), Gaps = 2/73 (2%) Query: 8 EVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWERGIEKPP 67 E I+ +P+RK K VPR RAP+AVK VREF+ +H KA V + +NEK+WERGI+K P Sbjct: 2 ERIYVIPLRKAKN-VPRTIRAPKAVKIVREFLMKHMKADTVKLDESINEKLWERGIQKIP 60 Query: 68 SRLRVKVKVEEED 80 R++VK V++ED Sbjct: 61 PRIKVKA-VKDED 72 >gi|11499648 LSU ribosomal protein L31E (rpl31E) [Archaeoglobus fulgidus] >gi|3914751|sp|O28213|RL31_ARCFU 50S RIBOSOMAL PROTEIN L31E >gi|7441070|pir||A69508 LSU ribosomal protein L31E (rpl31E) homolog - Archaeoglobus fulgidus >gi|2648485|gb|AAB89205.1| (AE000961) LSU ribosomal protein L31E (rpl31E) [Archaeoglobus fulgidus] Length = 88 Score = 74.1 bits (179), Expect = 3e-13 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Query: 8 EVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQ--EVIISTKVNEKIWERGIEK 65 E ++++ +R K PRW RA +A K+VR+F++RH K + V I T VNEKIWERG EK Sbjct: 7 ERVYSIRLRHKMKRYPRWLRAKKAAKYVRKFLSRHMKVEPENVKIDTAVNEKIWERGAEK 66 Query: 66 PPSRLRVK 73 PP+++RV+ Sbjct: 67 PPTKIRVR 74 >sp|Q9YD25|RL31_AERPE 50S RIBOSOMAL PROTEIN L31E >gi|7521368|pir||H72708 probable ribosomal protein L31 APE1087 - Aeropyrum pernix (strain K1) >gi|5104757|dbj|BAA80072.1| (AP000060) 105aa long hypothetical 50S ribosomal protein L31 [Aeropyrum pernix] Length = 105 Score = 73.0 bits (176), Expect = 7e-13 Identities = 36/73 (49%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Query: 24 RWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWERGIEKPPSRLRVKVKVEEEDRD- 82 R +RA RAV+ VREFV RH KA EV+I ++N IW R EKPP+R+++ V + EE+ + Sbjct: 22 RTRRAIRAVRMVREFVRRHTKADEVVIDNELNNYIWSRSREKPPARVKIIVSIREEEPEE 81 Query: 83 -GKKVRIAYVDLA 94 G+++R A V LA Sbjct: 82 GGERIRKAVVRLA 94 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.138 0.399 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33653246 Number of Sequences: 2977 Number of extensions: 1072573 Number of successful extensions: 3157 Number of sequences better than 1.0e-10: 5 Number of HSP's better than 0.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3152 Number of HSP's gapped (non-prelim): 5 length of query: 94 length of database: 189,106,746 effective HSP length: 51 effective length of query: 43 effective length of database: 158,583,909 effective search space: 6819108087 effective search space used: 6819108087 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 158 (66.0 bits)