BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB7388 (rplXA) DE:LSU ribosomal protein LXA (rplXA) (77 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F75066 lsu ribosomal protein lxa (rplxa) PAB7388 - Pyrococc... 154 8e-38 sp|O73977|RLX_PYRHO 50S RIBOSOMAL PROTEIN LX >gi|7521378|pir||C7... 146 2e-35 sp|O27647|RLX_METTH 50S RIBOSOMAL PROTEIN LX >gi|7482815|pir||B6... 75 1e-13 sp|P54052|RLX_METJA 50S RIBOSOMAL PROTEIN LX >gi|2129259|pir||C6... 68 1e-11 >pir||F75066 lsu ribosomal protein lxa (rplxa) PAB7388 - Pyrococcus abyssi (strain Orsay) >gi|5458940|emb|CAB50427.1| (AJ248287) LSU ribosomal protein LXA (rplXA) [Pyrococcus abyssi] Length = 77 Score = 154 bits (386), Expect = 8e-38 Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEI 60 MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEI Sbjct: 1 MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEI 60 Query: 61 RPEEAEDIVVRRLSLEL 77 RPEEAEDIVVRRLSLEL Sbjct: 61 RPEEAEDIVVRRLSLEL 77 >sp|O73977|RLX_PYRHO 50S RIBOSOMAL PROTEIN LX >gi|7521378|pir||C71166 probable ribosomal protein LX - Pyrococcus horikoshii >gi|3256933|dbj|BAA29616.1| (AP000002) 77aa long hypothetical 50S ribosomal protein LX [Pyrococcus horikoshii] Length = 77 Score = 146 bits (366), Expect = 2e-35 Identities = 72/77 (93%), Positives = 76/77 (98%) Query: 1 MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEI 60 M VKVFRVSGYFEK+GRKFKFTKEYRALKEEHVKELVYSDIGS+HKVKRRKIFIKEI+EI Sbjct: 1 MEVKVFRVSGYFEKDGRKFKFTKEYRALKEEHVKELVYSDIGSRHKVKRRKIFIKEIREI 60 Query: 61 RPEEAEDIVVRRLSLEL 77 +PEEAEDIVVRRLSLEL Sbjct: 61 KPEEAEDIVVRRLSLEL 77 >sp|O27647|RLX_METTH 50S RIBOSOMAL PROTEIN LX >gi|7482815|pir||B69082 ribosomal protein L18a - Methanobacterium thermoautotrophicum (strain Delta H) >gi|2622735|gb|AAB86083.1| (AE000920) ribosomal protein L18a [Methanobacterium thermoautotrophicum] Length = 78 Score = 74.5 bits (180), Expect = 1e-13 Identities = 36/73 (49%), Positives = 49/73 (66%) Query: 1 MNVKVFRVSGYFEKNGRKFKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEI 60 M K+FRV G F + FTKE A++EE + E +YS+ GSKH+V R K+ I+EI+EI Sbjct: 3 MKTKIFRVKGKFLMGDKLQPFTKELNAIREEEIYERLYSEFGSKHRVPRSKVKIEEIEEI 62 Query: 61 RPEEAEDIVVRRL 73 PEE +D VV+ L Sbjct: 63 SPEEVQDPVVKAL 75 >sp|P54052|RLX_METJA 50S RIBOSOMAL PROTEIN LX >gi|2129259|pir||C64374 ribosomal protein LX - Methanococcus jannaschii >gi|1591304|gb|AAB98588.1| (U67508) LSU ribosomal protein LXA [Methanococcus jannaschii] Length = 76 Score = 67.9 bits (163), Expect = 1e-11 Identities = 32/71 (45%), Positives = 49/71 (68%), Gaps = 1/71 (1%) Query: 4 KVFRVSGYFEKNGRK-FKFTKEYRALKEEHVKELVYSDIGSKHKVKRRKIFIKEIKEIRP 62 K+FR++G K G+ F KEY+ALK E E++YS+ G ++KVKR +I I I+EI+P Sbjct: 3 KIFRITGIMSKKGKDPLYFRKEYKALKPEDALEILYSEFGGRYKVKRSRIKILNIEEIKP 62 Query: 63 EEAEDIVVRRL 73 E+ D V+++L Sbjct: 63 EDVTDPVLKKL 73 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.320 0.139 0.373 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26062706 Number of Sequences: 2977 Number of extensions: 901610 Number of successful extensions: 3139 Number of sequences better than 1.0e-10: 4 Number of HSP's better than 0.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3134 Number of HSP's gapped (non-prelim): 4 length of query: 77 length of database: 189,106,746 effective HSP length: 56 effective length of query: 21 effective length of database: 155,591,474 effective search space: 3267420954 effective search space used: 3267420954 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 156 (65.2 bits)