BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10110 1041540 1041388 -51 !not a gene! (51 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75064 hypothetical protein PAB1373 - Pyrococcus abyssi (st... 75 1e-13 >pir||A75064 hypothetical protein PAB1373 - Pyrococcus abyssi (strain Orsay) >gi|5458919|emb|CAB50406.1| (AJ248287) hypothetical protein [Pyrococcus abyssi] Length = 270 Score = 74.5 bits (180), Expect = 1e-13 Identities = 32/51 (62%), Positives = 45/51 (87%) Query: 1 MSPGKTLNFTVIIKNTSELNDLYIIKPLIVYKVGNETHVEPMEPFYYATPP 51 + PG+++NFTV I NTS+LNDLY+IKPLIVY++GN+T++ P+E FY+AT P Sbjct: 206 IGPGESVNFTVRIVNTSKLNDLYVIKPLIVYQMGNKTNIMPLEVFYHATIP 256 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.317 0.139 0.409 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21491786 Number of Sequences: 2977 Number of extensions: 629362 Number of successful extensions: 1213 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1212 Number of HSP's gapped (non-prelim): 1 length of query: 51 length of database: 189,106,746 effective HSP length: 30 effective length of query: 21 effective length of database: 171,152,136 effective search space: 3594194856 effective search space used: 3594194856 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 156 (65.2 bits)