BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10193 1019872 1019639 -78 !not a gene! (78 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71063 hypothetical protein PH1206 - Pyrococcus horikoshii ... 120 2e-27 >pir||H71063 hypothetical protein PH1206 - Pyrococcus horikoshii >gi|3257623|dbj|BAA30306.1| (AP000005) 170aa long hypothetical protein [Pyrococcus horikoshii] Length = 170 Score = 120 bits (297), Expect = 2e-27 Identities = 62/76 (81%), Positives = 68/76 (88%) Query: 3 GKNVPARNVMTVILATHGISGFTSIVNILSFSSSKILVAMTAGTLQPKAKTIGIMAFPGS 62 GKNVPAR V+TVILAT GI+G SIV ILSFSSS ILVA+TAGTLQP AKTIGI+AFPGS Sbjct: 25 GKNVPARKVITVILATQGINGLISIVKILSFSSSSILVAITAGTLQPNAKTIGIIAFPGS 84 Query: 63 LNILKYLSMTAATLAK 78 LN LKYLS+TAATLA+ Sbjct: 85 LNTLKYLSITAATLAR 100 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.130 0.345 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23494584 Number of Sequences: 2977 Number of extensions: 619052 Number of successful extensions: 2073 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2072 Number of HSP's gapped (non-prelim): 1 length of query: 78 length of database: 189,106,746 effective HSP length: 57 effective length of query: 21 effective length of database: 154,992,987 effective search space: 3254852727 effective search space used: 3254852727 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 156 (65.2 bits)