BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10289 991872 991636 -79 !not a gene! (79 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71065 hypothetical protein PH1220 - Pyrococcus horikoshii ... 66 5e-11 >pir||F71065 hypothetical protein PH1220 - Pyrococcus horikoshii >gi|3257637|dbj|BAA30320.1| (AP000005) 117aa long hypothetical protein [Pyrococcus horikoshii] Length = 117 Score = 66.3 bits (159), Expect = 5e-11 Identities = 34/64 (53%), Positives = 34/64 (53%) Query: 2 SASLTSTIATMAANPRDXXXXXXXXXMFTLCFPRTPLIFAKTPGLXXXXXXXXXXFFPGR 61 S L STIATMAA P D MF C PR PLIFAKTPGL FPGR Sbjct: 53 SELLMSTIATMAAIPNDSNSSLSLKSMFIPCLPRVPLIFAKTPGLSTTISSTSTSLFPGR 112 Query: 62 ATLS 65 A LS Sbjct: 113 AILS 116 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.129 0.391 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19227700 Number of Sequences: 2977 Number of extensions: 424074 Number of successful extensions: 284 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 283 Number of HSP's gapped (non-prelim): 1 length of query: 79 length of database: 189,106,746 effective HSP length: 51 effective length of query: 28 effective length of database: 158,583,909 effective search space: 4440349452 effective search space used: 4440349452 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 157 (65.6 bits)