BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10416 948674 948453 -74 !not a gene! (74 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71091 hypothetical protein PH0994 - Pyrococcus horikoshii ... 113 2e-25 >pir||E71091 hypothetical protein PH0994 - Pyrococcus horikoshii >gi|3257408|dbj|BAA30091.1| (AP000004) 107aa long hypothetical protein [Pyrococcus horikoshii] Length = 107 Score = 113 bits (280), Expect = 2e-25 Identities = 58/74 (78%), Positives = 61/74 (82%) Query: 1 MKSISGFLTLCPAGSSLNSHLLTSSRLRRCQIFSLASGKNGSSRIPRAFTICKEMLTVVP 60 +KSIS FLTL PAGSSLN H LTSSRLRRC IFSLASG+ GSS IPRA TI +MLTVVP Sbjct: 12 LKSISAFLTLWPAGSSLNFHFLTSSRLRRCHIFSLASGRKGSSSIPRALTIWSDMLTVVP 71 Query: 61 VLTLSSFAVFHGCL 74 VL LSS AVF GCL Sbjct: 72 VLALSSLAVFQGCL 85 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.136 0.402 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24458541 Number of Sequences: 2977 Number of extensions: 700258 Number of successful extensions: 2063 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2062 Number of HSP's gapped (non-prelim): 1 length of query: 74 length of database: 189,106,746 effective HSP length: 53 effective length of query: 21 effective length of database: 157,386,935 effective search space: 3305125635 effective search space used: 3305125635 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 156 (65.2 bits)