BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10478 924127 923891 -79 !not a gene! (79 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H71094 hypothetical protein PH1021 - Pyrococcus horikoshii ... 116 3e-26 >pir||H71094 hypothetical protein PH1021 - Pyrococcus horikoshii >gi|3257435|dbj|BAA30118.1| (AP000004) 120aa long hypothetical protein [Pyrococcus horikoshii] Length = 120 Score = 116 bits (289), Expect = 3e-26 Identities = 59/79 (74%), Positives = 61/79 (76%) Query: 1 MNXXXXXXXXXXXTFPVGSSGKGVLALLITSSFSGIISNPSLAFGVKFTMPSTTITSSLF 60 MN TFPVGS G GVLALLITSSFSGI SNPS A GVKFT+PSTT+TSSLF Sbjct: 1 MNLLSSLVSSSAFTFPVGSRGNGVLALLITSSFSGITSNPSFALGVKFTIPSTTMTSSLF 60 Query: 61 SFGISLNISWGTFFFGAVT 79 S GISLNISW TFFFGAVT Sbjct: 61 SLGISLNISWETFFFGAVT 79 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.322 0.136 0.396 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23580240 Number of Sequences: 2977 Number of extensions: 716690 Number of successful extensions: 1469 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1468 Number of HSP's gapped (non-prelim): 1 length of query: 79 length of database: 189,106,746 effective HSP length: 51 effective length of query: 28 effective length of database: 158,583,909 effective search space: 4440349452 effective search space used: 4440349452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 157 (65.6 bits)