BLASTP 2.0.10 [Aug-26-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= PABs10515 916012 915803 -70 !not a gene!
         (70 letters)

Database: ./suso.pep; /banques/blast2/nr.pep
           598,487 sequences; 189,106,746 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||B71075 hypothetical protein PH1293 - Pyrococcus horikoshii ...    66  6e-11

>pir||B71075 hypothetical protein PH1293 - Pyrococcus horikoshii
           >gi|3257713|dbj|BAA30396.1| (AP000005) 112aa long
           hypothetical protein [Pyrococcus horikoshii]
           Length = 112
           
 Score = 65.6 bits (157), Expect = 6e-11
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 23  SPLHPMHPRPIEGHLALQPPRVTGPKHGTPLFKRTHSYSLSLHSKQTG 70
           +PL PM   P  GHLAL P  VTGP+ G+P  +RTH Y LSLHS+QTG
Sbjct: 65  APLQPMQAIPNPGHLALHPALVTGPRQGSPFSRRTHGYPLSLHSRQTG 112


  Database: ./suso.pep
    Posted date:  Jul 6, 2001  5:57 PM
  Number of letters in database: 840,471
  Number of sequences in database:  2977
  
  Database: /banques/blast2/nr.pep
    Posted date:  Dec 14, 2000 12:46 PM
  Number of letters in database: 188,266,275
  Number of sequences in database:  595,510
  
Lambda     K      H
   0.317    0.135    0.417 

Gapped
Lambda     K      H
   0.270   0.0470    0.230 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31349694
Number of Sequences: 2977
Number of extensions: 1266603
Number of successful extensions: 2551
Number of sequences better than 1.0e-10: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2550
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 189,106,746
effective HSP length: 49
effective length of query: 21
effective length of database: 159,780,883
effective search space: 3355398543
effective search space used: 3355398543
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 156 (65.2 bits)