BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PABs10559 904197 903931 -89 !not a gene! (89 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E71163 hypothetical protein PH0506 - Pyrococcus horikoshii ... 101 3e-21 >pir||E71163 hypothetical protein PH0506 - Pyrococcus horikoshii >gi|3256911|dbj|BAA29594.1| (AP000002) 123aa long hypothetical protein [Pyrococcus horikoshii] Length = 123 Score = 101 bits (248), Expect = 3e-21 Identities = 49/65 (75%), Positives = 53/65 (81%) Query: 1 MILLVGFKAFIAYCGIIESSEYWIFLNSSLGKDIKSLPLKIAEPPLYSIGGFLRIKEWTR 60 +I LVGF AFIAYCGII++S YWIFL SSL IKS PLKIA PPL IGGFLRI+EWTR Sbjct: 29 LIFLVGFNAFIAYCGIIDNSLYWIFLASSLESFIKSFPLKIAFPPLCVIGGFLRIREWTR 88 Query: 61 VDLPQ 65 VD PQ Sbjct: 89 VDFPQ 93 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.325 0.146 0.455 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25152351 Number of Sequences: 2977 Number of extensions: 774270 Number of successful extensions: 6208 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6207 Number of HSP's gapped (non-prelim): 1 length of query: 89 length of database: 189,106,746 effective HSP length: 45 effective length of query: 44 effective length of database: 162,174,831 effective search space: 7135692564 effective search space used: 7135692564 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.6 bits) S2: 158 (66.0 bits)